BLASTX nr result
ID: Rauwolfia21_contig00049693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00049693 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720113.1| ycf3 [Jatropha curcas] gi|224979566|gb|ACN72... 78 1e-12 ref|YP_538849.1| photosystem I assembly protein Ycf3 [Solanum bu... 76 5e-12 ref|YP_005090179.1| ycf3 gene product (chloroplast) [Ricinus com... 76 5e-12 dbj|BAO50882.1| photosystem I assembly protein ycf3 (mitochondri... 75 7e-12 ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) ... 75 7e-12 ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium ... 75 7e-12 gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] 75 7e-12 ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chlorop... 75 7e-12 ref|YP_004327663.1| photosystem I assembly protein ycf3 [Hevea b... 75 7e-12 ref|YP_784474.1| photosystem I assembly protein ycf3 [Piper ceno... 75 7e-12 gb|AGJ51257.1| photosystem I assembly protein Ycf3 (chloroplast)... 75 9e-12 gb|AEZ48760.1| photosystem I assembly protein Ycf3, partial [Cen... 75 1e-11 gb|ABU85615.1| photosystem I assembly protein ycf3 [Scaevola aem... 74 2e-11 ref|YP_817483.1| photosystem I assembly protein ycf3 [Coffea ara... 74 2e-11 ref|YP_009002259.1| photosystem I assembly protein Ycf3 (chlorop... 74 2e-11 emb|CCQ71621.1| photosystem I assembly protein Ycf3 (chloroplast... 74 2e-11 ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) ... 74 2e-11 ref|YP_008993263.1| hypothetical chloroplast RF34 (chloroplast) ... 74 2e-11 ref|YP_008994480.1| hypothetical chloroplast RF34 (chloroplast) ... 74 2e-11 ref|YP_008963396.1| hypothetical chloroplast RF34 (chloroplast) ... 74 2e-11 >ref|YP_002720113.1| ycf3 [Jatropha curcas] gi|224979566|gb|ACN72693.1| ycf3 [Jatropha curcas] Length = 168 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+TT NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRTTGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_538849.1| photosystem I assembly protein Ycf3 [Solanum bulbocastanum] gi|122232537|sp|Q2MII6.1|YCF3_SOLBU RecName: Full=Photosystem I assembly protein Ycf3 gi|84371896|gb|ABC56214.1| photosystem I assembly protein ycf3 [Solanum bulbocastanum] Length = 168 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+T NFIDKTFSIV+NILL +IPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRTNGNFIDKTFSIVANILLRVIPTTSGEKEAFTYYRDG 42 >ref|YP_005090179.1| ycf3 gene product (chloroplast) [Ricinus communis] gi|339516166|gb|AEJ82556.1| photosystem I assembly protein Ycf3 [Ricinus communis] Length = 169 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ T NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRITGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >dbj|BAO50882.1| photosystem I assembly protein ycf3 (mitochondrion) [Hevea brasiliensis] gi|584592177|dbj|BAO50928.1| photosystem I assembly protein ycf3 (mitochondrion) [Hevea brasiliensis] Length = 168 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ T NFIDKTFS+V+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRITGNFIDKTFSVVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] gi|403226782|gb|AFR25661.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] Length = 169 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDGA 197 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDGA Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGA 43 >ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium hirsutum] gi|119368500|ref|YP_913188.1| PSI accumulation protein [Gossypium barbadense] gi|325210931|ref|YP_004286005.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|372290933|ref|YP_005087694.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|372291032|ref|YP_005087790.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|372291386|ref|YP_005088281.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|372291484|ref|YP_005088377.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291774|ref|YP_005088917.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|372291858|ref|YP_005089000.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|386800838|ref|YP_006303492.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|394830627|ref|YP_006503278.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium incanum] gi|394830714|ref|YP_006503361.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium somalense] gi|394830889|ref|YP_006503527.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|394830976|ref|YP_006503610.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium robinsonii] gi|570758969|ref|YP_008992551.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium bickii] gi|570759057|ref|YP_008992896.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium sturtianum] gi|570759577|ref|YP_008992638.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium herbaceum] gi|570759663|ref|YP_008992724.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium longicalyx] gi|570879914|ref|YP_008992810.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium stocksii] gi|122226162|sp|Q2L906.1|YCF3_GOSHI RecName: Full=Photosystem I assembly protein Ycf3 gi|125991253|sp|A0ZZ36.1|YCF3_GOSBA RecName: Full=Photosystem I assembly protein Ycf3 gi|85687417|gb|ABC73629.1| photosystem I assembly protein ycf3 [Gossypium hirsutum] gi|119224862|dbj|BAF41248.1| PSI accumulation protein [Gossypium barbadense] gi|290775793|gb|ADD62289.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|318084317|gb|ADV38793.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|318084400|gb|ADV38875.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|318084485|gb|ADV38959.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084569|gb|ADV39042.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|318084651|gb|ADV39123.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|318084737|gb|ADV39208.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|326457128|gb|ADZ74391.1| hypothetical chloroplast RF34 [Gossypium bickii] gi|326457216|gb|ADZ74478.1| hypothetical chloroplast RF34 [Gossypium herbaceum] gi|326457302|gb|ADZ74563.1| hypothetical chloroplast RF34 [Gossypium longicalyx] gi|326457389|gb|ADZ74649.1| hypothetical chloroplast RF34 [Gossypium stocksii] gi|326457477|gb|ADZ74736.1| hypothetical chloroplast RF34 [Gossypium sturtianum] gi|329317072|gb|AEB90431.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|329317156|gb|AEB90514.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317240|gb|AEB90597.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317324|gb|AEB90680.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317408|gb|AEB90763.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317492|gb|AEB90846.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|335354332|gb|AEH42952.1| photosystem I assembly protein Ycf3 [Gossypium incanum] gi|335354416|gb|AEH43035.1| photosystem I assembly protein Ycf3 [Gossypium somalense] gi|335354584|gb|AEH43201.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|335354668|gb|AEH43284.1| photosystem I assembly protein Ycf3 [Gossypium robinsonii] Length = 168 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRSQ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] Length = 170 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDGA 197 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDGA Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGA 43 >ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] gi|570758881|ref|YP_008992465.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium anomalum] gi|326457040|gb|ADZ74304.1| hypothetical chloroplast RF34 [Gossypium anomalum] gi|335354500|gb|AEH43118.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] Length = 168 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRSQ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_004327663.1| photosystem I assembly protein ycf3 [Hevea brasiliensis] gi|308523508|gb|ADO33558.1| photosystem I assembly protein ycf3 [Hevea brasiliensis] Length = 168 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ T NFIDKTFS+V+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRITGNFIDKTFSVVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_784474.1| photosystem I assembly protein ycf3 [Piper cenocladum] gi|122164361|sp|Q06GQ9.1|YCF3_PIPCE RecName: Full=Photosystem I assembly protein Ycf3 gi|112253752|gb|ABI14473.1| photosystem I assembly protein ycf3 [Piper cenocladum] Length = 168 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRSQ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >gb|AGJ51257.1| photosystem I assembly protein Ycf3 (chloroplast) [Solanum carolinense] Length = 44 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDGA 197 MPRS+ NFIDKTFSIV+NILL +IPTTSGEKEAFTYYRDGA Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRVIPTTSGEKEAFTYYRDGA 43 >gb|AEZ48760.1| photosystem I assembly protein Ycf3, partial [Centrolepis monogyna] Length = 169 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+T NFIDKTFSIV+NILL IIPTTSGEK+AFTYYRDG Sbjct: 1 MPRSRTNGNFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDG 42 >gb|ABU85615.1| photosystem I assembly protein ycf3 [Scaevola aemula] Length = 168 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRVNGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDG 42 >ref|YP_817483.1| photosystem I assembly protein ycf3 [Coffea arabica] gi|122153622|sp|A0A336.1|YCF3_COFAR RecName: Full=Photosystem I assembly protein Ycf3 gi|116242165|gb|ABJ89680.1| photosystem I assembly protein ycf3 [Coffea arabica] Length = 168 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRSQ NFIDKTFSIV+NILL IIPTTSGE+EAFTYYRDG Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEREAFTYYRDG 42 >ref|YP_009002259.1| photosystem I assembly protein Ycf3 (chloroplast) [Pinguicula ehlersiae] gi|575882141|emb|CDL78815.1| photosystem I assembly protein Ycf3 (chloroplast) [Pinguicula ehlersiae] Length = 168 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDG 42 >emb|CCQ71621.1| photosystem I assembly protein Ycf3 (chloroplast) [Salvia miltiorrhiza] Length = 168 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDG 42 >ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|576312302|ref|YP_009000186.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] gi|555944022|gb|AGZ17926.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|555944275|gb|AGZ18176.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] Length = 168 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008993263.1| hypothetical chloroplast RF34 (chloroplast) [Magnolia dealbata] Length = 168 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008994480.1| hypothetical chloroplast RF34 (chloroplast) [Hypseocharis bilobata] gi|540067559|gb|AGV02910.1| hypothetical chloroplast RF34 (chloroplast) [Hypseocharis bilobata] Length = 168 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRS+ NFIDKTFSIV+NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008963396.1| hypothetical chloroplast RF34 (chloroplast) [Sedum sarmentosum] gi|402797531|gb|AFQ99063.1| hypothetical chloroplast RF34 (chloroplast) [Sedum sarmentosum] Length = 169 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 69 MPRSQTTRNFIDKTFSIVSNILL*IIPTTSGEKEAFTYYRDG 194 MPRSQ NFIDKTF+I++NILL IIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSQINGNFIDKTFTIIANILLQIIPTTSGEKEAFTYYRDG 42