BLASTX nr result
ID: Rauwolfia21_contig00048894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00048894 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516852.1| pax transcription activation domain interact... 57 3e-06 ref|XP_003542910.2| PREDICTED: BRCT-containing protein 1-like [G... 56 6e-06 ref|XP_003542911.2| PREDICTED: uncharacterized protein LOC100776... 56 6e-06 >ref|XP_002516852.1| pax transcription activation domain interacting protein, putative [Ricinus communis] gi|223543940|gb|EEF45466.1| pax transcription activation domain interacting protein, putative [Ricinus communis] Length = 1178 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 269 QRLEYERHQLFTDIVKRTRSTIWLKRNSSMYIPV 168 Q+LEYERHQLF D VKRTRSTIWL++ S +IPV Sbjct: 1141 QKLEYERHQLFADHVKRTRSTIWLRKGSDRFIPV 1174 >ref|XP_003542910.2| PREDICTED: BRCT-containing protein 1-like [Glycine max] Length = 595 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 269 QRLEYERHQLFTDIVKRTRSTIWLKRNSSMYIPV 168 Q+LEY+RH+LF DIVK+TRST+WLKR+ +IPV Sbjct: 558 QKLEYQRHRLFADIVKKTRSTLWLKRDDRTFIPV 591 >ref|XP_003542911.2| PREDICTED: uncharacterized protein LOC100776747 isoform X1 [Glycine max] Length = 1088 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 269 QRLEYERHQLFTDIVKRTRSTIWLKRNSSMYIPV 168 Q+LEY+RH+LF DIVK+TRST+WLKR+ +IPV Sbjct: 1051 QKLEYQRHRLFADIVKKTRSTLWLKRDDRTFIPV 1084