BLASTX nr result
ID: Rauwolfia21_contig00048277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00048277 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360053.1| PREDICTED: uncharacterized protein At3g15000... 64 3e-08 gb|EOY13212.1| Cobalt ion binding [Theobroma cacao] 62 6e-08 ref|XP_004251891.1| PREDICTED: uncharacterized protein At3g15000... 62 8e-08 ref|XP_004248249.1| PREDICTED: uncharacterized protein At3g15000... 62 8e-08 ref|XP_006358944.1| PREDICTED: uncharacterized protein At3g15000... 61 2e-07 ref|XP_006358943.1| PREDICTED: uncharacterized protein At3g15000... 61 2e-07 gb|ESW21401.1| hypothetical protein PHAVU_005G067700g [Phaseolus... 61 2e-07 ref|XP_004489047.1| PREDICTED: uncharacterized protein At3g15000... 61 2e-07 ref|XP_003543219.1| PREDICTED: uncharacterized protein At3g15000... 61 2e-07 gb|EPS74428.1| hypothetical protein M569_00328, partial [Genlise... 60 4e-07 gb|EMS47466.1| hypothetical protein TRIUR3_28031 [Triticum urartu] 60 4e-07 dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 dbj|BAJ93961.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 ref|XP_006852447.1| hypothetical protein AMTR_s00021p00105410 [A... 59 5e-07 ref|XP_004974019.1| PREDICTED: uncharacterized protein At3g15000... 59 7e-07 ref|XP_002465768.1| hypothetical protein SORBIDRAFT_01g045460 [S... 59 7e-07 ref|XP_003540481.1| PREDICTED: uncharacterized protein At3g15000... 58 1e-06 ref|XP_002524267.1| DAG protein, chloroplast precursor, putative... 58 1e-06 gb|ABK26281.1| unknown [Picea sitchensis] 58 1e-06 gb|EAZ45317.1| hypothetical protein OsJ_29960 [Oryza sativa Japo... 58 1e-06 >ref|XP_006360053.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Solanum tuberosum] Length = 411 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 120 SFVLNLRTFY-SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 S++ L T SEEEARMKIYSVSTRHYYAFGALVSEELSY Sbjct: 117 SYIKTLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSY 157 >gb|EOY13212.1| Cobalt ion binding [Theobroma cacao] Length = 402 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTRHYYAFGALVSEELSY Sbjct: 143 SEEEARMKIYSVSTRHYYAFGALVSEELSY 172 >ref|XP_004251891.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Solanum lycopersicum] Length = 429 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 120 SFVLNLRTFY-SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 S++ L T SEEEARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 109 SYIKTLATIVGSEEEARMKIYSVSTRHYFAFGALVSEELSY 149 >ref|XP_004248249.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Solanum lycopersicum] Length = 391 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 120 SFVLNLRTFY-SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 S++ L T SEEEARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 117 SYIKTLATIVGSEEEARMKIYSVSTRHYFAFGALVSEELSY 157 >ref|XP_006358944.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 378 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/41 (75%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 120 SFVLNLRTFY-SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 S++ L T SEE+ARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 109 SYIKTLATIVGSEEDARMKIYSVSTRHYFAFGALVSEELSY 149 >ref|XP_006358943.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 403 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/41 (75%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 120 SFVLNLRTFY-SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 S++ L T SEE+ARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 109 SYIKTLATIVGSEEDARMKIYSVSTRHYFAFGALVSEELSY 149 >gb|ESW21401.1| hypothetical protein PHAVU_005G067700g [Phaseolus vulgaris] Length = 405 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 128 SEEEARMKIYSVSTRHYFAFGALVSEELSY 157 >ref|XP_004489047.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Cicer arietinum] Length = 409 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 129 SEEEARMKIYSVSTRHYFAFGALVSEELSY 158 >ref|XP_003543219.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Glycine max] Length = 401 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 127 SEEEARMKIYSVSTRHYFAFGALVSEELSY 156 >gb|EPS74428.1| hypothetical protein M569_00328, partial [Genlisea aurea] Length = 363 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTRHY+AFGALVSE+LSY Sbjct: 93 SEEEARMKIYSVSTRHYFAFGALVSEDLSY 122 >gb|EMS47466.1| hypothetical protein TRIUR3_28031 [Triticum urartu] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SE+EARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 32 SEDEARMKIYSVSTRHYFAFGALVSEELSY 61 >dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 415 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SE+EARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 123 SEDEARMKIYSVSTRHYFAFGALVSEELSY 152 >dbj|BAJ93961.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 415 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SE+EARMKIYSVSTRHY+AFGALVSEELSY Sbjct: 123 SEDEARMKIYSVSTRHYFAFGALVSEELSY 152 >ref|XP_006852447.1| hypothetical protein AMTR_s00021p00105410 [Amborella trichopoda] gi|548856058|gb|ERN13914.1| hypothetical protein AMTR_s00021p00105410 [Amborella trichopoda] Length = 422 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTRHY+AFG LVSEELSY Sbjct: 140 SEEEARMKIYSVSTRHYFAFGCLVSEELSY 169 >ref|XP_004974019.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Setaria italica] Length = 403 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEAR KIYSVSTRHY+AFGALVSEELSY Sbjct: 131 SEEEARQKIYSVSTRHYFAFGALVSEELSY 160 >ref|XP_002465768.1| hypothetical protein SORBIDRAFT_01g045460 [Sorghum bicolor] gi|241919622|gb|EER92766.1| hypothetical protein SORBIDRAFT_01g045460 [Sorghum bicolor] Length = 388 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEAR KIYSVSTRHY+AFGALVSEELSY Sbjct: 123 SEEEARQKIYSVSTRHYFAFGALVSEELSY 152 >ref|XP_003540481.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Glycine max] Length = 363 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELS 4 SEEEARMKIYSVSTRHY+AFGALVSEELS Sbjct: 129 SEEEARMKIYSVSTRHYFAFGALVSEELS 157 >ref|XP_002524267.1| DAG protein, chloroplast precursor, putative [Ricinus communis] gi|223536458|gb|EEF38106.1| DAG protein, chloroplast precursor, putative [Ricinus communis] Length = 389 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVSTR YYAFGALVSEELSY Sbjct: 128 SEEEARMKIYSVSTRCYYAFGALVSEELSY 157 >gb|ABK26281.1| unknown [Picea sitchensis] Length = 274 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEARMKIYSVST+HY+AFG LVSEELSY Sbjct: 137 SEEEARMKIYSVSTKHYFAFGCLVSEELSY 166 >gb|EAZ45317.1| hypothetical protein OsJ_29960 [Oryza sativa Japonica Group] Length = 396 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 90 SEEEARMKIYSVSTRHYYAFGALVSEELSY 1 SEEEAR KIYSVSTRHY+AFGALVSEELSY Sbjct: 124 SEEEARHKIYSVSTRHYFAFGALVSEELSY 153