BLASTX nr result
ID: Rauwolfia21_contig00048059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00048059 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ18161.1| hypothetical protein PRUPE_ppa015390mg [Prunus pe... 60 2e-07 ref|XP_006365187.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004306135.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006656718.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_004964651.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|NP_001057005.1| Os06g0185800 [Oryza sativa Japonica Group] g... 59 9e-07 gb|AFW85541.1| hypothetical protein ZEAMMB73_780855 [Zea mays] 59 9e-07 ref|XP_003560982.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_002309359.1| pentatricopeptide repeat-containing family p... 59 9e-07 gb|EEC80145.1| hypothetical protein OsI_21946 [Oryza sativa Indi... 59 9e-07 gb|EXB42930.1| hypothetical protein L484_013952 [Morus notabilis] 58 1e-06 gb|EOY11720.1| Pentatricopeptide repeat (PPR) superfamily protei... 58 1e-06 ref|NP_194799.1| pentatricopeptide repeat-containing protein [Ar... 58 2e-06 ref|XP_006646479.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006412675.1| hypothetical protein EUTSA_v10024455mg [Eutr... 58 2e-06 gb|EOY31480.1| Pentatricopeptide repeat (PPR) superfamily protei... 58 2e-06 ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Caps... 58 2e-06 ref|XP_006285141.1| hypothetical protein CARUB_v10006490mg [Caps... 58 2e-06 gb|EMJ05798.1| hypothetical protein PRUPE_ppa002987mg [Prunus pe... 58 2e-06 >gb|EMJ18161.1| hypothetical protein PRUPE_ppa015390mg [Prunus persica] Length = 704 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT RLII+RD NRFH F+DG CSCADYW Sbjct: 674 ISKVTNRLIIVRDANRFHQFQDGKCSCADYW 704 >ref|XP_006365187.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Solanum tuberosum] Length = 708 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT R+I++RDVNRFHSF++G CSCADYW Sbjct: 678 ISKVTMRVIVVRDVNRFHSFQNGSCSCADYW 708 >ref|XP_004306135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Fragaria vesca subsp. vesca] Length = 704 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT R+II+RD NRFH F+DG CSCADYW Sbjct: 674 ISKVTNRVIIVRDTNRFHHFQDGRCSCADYW 704 >ref|XP_006656718.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Oryza brachyantha] Length = 672 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+RLI++RD +RFH FRDG CSC DYW Sbjct: 642 ISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 672 >ref|XP_004964651.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Setaria italica] Length = 788 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+RLI++RD +RFH FRDG CSC DYW Sbjct: 758 ISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 788 >ref|NP_001057005.1| Os06g0185800 [Oryza sativa Japonica Group] gi|55773756|dbj|BAD72439.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113595045|dbj|BAF18919.1| Os06g0185800 [Oryza sativa Japonica Group] gi|125596288|gb|EAZ36068.1| hypothetical protein OsJ_20378 [Oryza sativa Japonica Group] Length = 787 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+RLI++RD +RFH FRDG CSC DYW Sbjct: 757 ISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 787 >gb|AFW85541.1| hypothetical protein ZEAMMB73_780855 [Zea mays] Length = 787 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+RLI++RD +RFH FRDG CSC DYW Sbjct: 757 ISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 787 >ref|XP_003560982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Brachypodium distachyon] Length = 796 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+RLI++RD +RFH FRDG CSC DYW Sbjct: 766 ISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 796 >ref|XP_002309359.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222855335|gb|EEE92882.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 605 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 +SK+TKR+I++RD NRFH F+DG CSC DYW Sbjct: 575 LSKITKRVIVVRDANRFHHFKDGLCSCGDYW 605 >gb|EEC80145.1| hypothetical protein OsI_21946 [Oryza sativa Indica Group] Length = 603 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+RLI++RD +RFH FRDG CSC DYW Sbjct: 573 ISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 603 >gb|EXB42930.1| hypothetical protein L484_013952 [Morus notabilis] Length = 781 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKVT+R+I++RD NRFH F+DG CSC DYW Sbjct: 751 ISKVTERVIVVRDANRFHHFKDGVCSCGDYW 781 >gb|EOY11720.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508719824|gb|EOY11721.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 731 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 I+KVTKR II+RD NRFH F+DG+CSC DYW Sbjct: 701 IAKVTKREIILRDANRFHHFKDGFCSCRDYW 731 >ref|NP_194799.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75208664|sp|Q9SUH6.1|PP341_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g30700; AltName: Full=Protein DYW9 gi|5725434|emb|CAB52443.1| putative protein [Arabidopsis thaliana] gi|7269971|emb|CAB79788.1| putative protein [Arabidopsis thaliana] gi|332660398|gb|AEE85798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 792 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK+T+R+I++RD NRFH F+DG CSC DYW Sbjct: 762 ISKITERVIVVRDANRFHHFKDGVCSCGDYW 792 >ref|XP_006646479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Oryza brachyantha] Length = 572 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK T+R II+RDVNRFH FRDG CSC DYW Sbjct: 542 ISKYTEREIIVRDVNRFHHFRDGVCSCGDYW 572 >ref|XP_006412675.1| hypothetical protein EUTSA_v10024455mg [Eutrema salsugineum] gi|557113845|gb|ESQ54128.1| hypothetical protein EUTSA_v10024455mg [Eutrema salsugineum] Length = 790 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK+T+R+I++RD NRFH F+DG CSC DYW Sbjct: 760 ISKITERVIVVRDANRFHHFKDGVCSCGDYW 790 >gb|EOY31480.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 801 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK+T+R+I++RD NRFH F+DG CSC DYW Sbjct: 771 ISKITERVIVVRDANRFHHFKDGVCSCGDYW 801 >ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Cicer arietinum] Length = 783 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK+T+R+I++RD NRFH F+DG CSC DYW Sbjct: 753 ISKITERVIVVRDANRFHHFKDGICSCGDYW 783 >ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Capsella rubella] gi|482554637|gb|EOA18830.1| hypothetical protein CARUB_v10007444mg [Capsella rubella] Length = 790 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK+T+R+I++RD NRFH F+DG CSC DYW Sbjct: 760 ISKITERVIVVRDANRFHHFKDGVCSCGDYW 790 >ref|XP_006285141.1| hypothetical protein CARUB_v10006490mg [Capsella rubella] gi|482553846|gb|EOA18039.1| hypothetical protein CARUB_v10006490mg [Capsella rubella] Length = 710 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISKV+KR I+IRD NRFH FRDG CSC DYW Sbjct: 680 ISKVSKRYIVIRDSNRFHHFRDGKCSCCDYW 710 >gb|EMJ05798.1| hypothetical protein PRUPE_ppa002987mg [Prunus persica] Length = 614 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +3 Query: 3 ISKVTKRLIIIRDVNRFHSFRDGYCSCADYW 95 ISK+T+R+I++RD NRFH F+DG CSC DYW Sbjct: 584 ISKITERVIVVRDANRFHHFKDGVCSCGDYW 614