BLASTX nr result
ID: Rauwolfia21_contig00045936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00045936 (313 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353466.1| PREDICTED: protein tesmin/TSO1-like CXC 5-li... 57 3e-06 >ref|XP_006353466.1| PREDICTED: protein tesmin/TSO1-like CXC 5-like [Solanum tuberosum] Length = 554 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/79 (39%), Positives = 41/79 (51%), Gaps = 2/79 (2%) Frame = +2 Query: 83 PQLQSKSFPARS--KLPLKRKTVSVSSLLYPPPRPTLPAAKFTLTPQLDTIKLKGEVPDI 256 PQLQ P + +P+K+ V + PP+P P A+ P+ ++K P Sbjct: 19 PQLQPPPQPQQHIVLMPMKQTAVPPNHPSIRPPKPESPRAR----PRQSASEVKDGTPKK 74 Query: 257 QKNCKCKQSRCLKLYCLCF 313 QK C CK SRCLKLYC CF Sbjct: 75 QKQCNCKHSRCLKLYCECF 93