BLASTX nr result
ID: Rauwolfia21_contig00045866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00045866 (558 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25674.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002529002.1| ribosome biogenesis protein bop1, putative [... 59 8e-07 >emb|CBI25674.3| unnamed protein product [Vitis vinifera] Length = 706 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 2 HFKTVSSVEWHRKGDYFSTLMPADILFPVLFMLV 103 HFKTVSSVEWHRKGDY ST+MPADIL +LF ++ Sbjct: 504 HFKTVSSVEWHRKGDYLSTVMPADILLMILFSIL 537 >ref|XP_002529002.1| ribosome biogenesis protein bop1, putative [Ricinus communis] gi|223531542|gb|EEF33372.1| ribosome biogenesis protein bop1, putative [Ricinus communis] Length = 735 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 2 HFKTVSSVEWHRKGDYFSTLMPADILFPVL 91 HFKTVSSVEWHRKGDYF TLMPADIL +L Sbjct: 516 HFKTVSSVEWHRKGDYFCTLMPADILLLIL 545