BLASTX nr result
ID: Rauwolfia21_contig00045278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00045278 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526943.1| conserved hypothetical protein [Ricinus comm... 69 6e-10 ref|XP_006369953.1| hypothetical protein POPTR_0001s36060g [Popu... 68 1e-09 gb|EMJ18492.1| hypothetical protein PRUPE_ppa018289mg [Prunus pe... 64 2e-08 gb|EPS71790.1| hypothetical protein M569_02970 [Genlisea aurea] 55 7e-06 >ref|XP_002526943.1| conserved hypothetical protein [Ricinus communis] gi|223533695|gb|EEF35430.1| conserved hypothetical protein [Ricinus communis] Length = 76 Score = 68.9 bits (167), Expect = 6e-10 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 54 FALLTGCNNNCDVACCYCDIRKQPPLCLQCCEEGP 158 F +TGCNN+CD ACC CDI+KQPPLC+QCC+E P Sbjct: 42 FLTITGCNNDCDTACCNCDIQKQPPLCVQCCKEDP 76 >ref|XP_006369953.1| hypothetical protein POPTR_0001s36060g [Populus trichocarpa] gi|550348990|gb|ERP66522.1| hypothetical protein POPTR_0001s36060g [Populus trichocarpa] Length = 77 Score = 67.8 bits (164), Expect = 1e-09 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 54 FALLTGCNNNCDVACCYCDIRKQPPLCLQCCEEGP 158 F + GCNN+CD ACC CDI+KQPPLC+QCC+E P Sbjct: 43 FVTVAGCNNDCDTACCNCDIKKQPPLCVQCCQEDP 77 >gb|EMJ18492.1| hypothetical protein PRUPE_ppa018289mg [Prunus persica] Length = 77 Score = 64.3 bits (155), Expect = 2e-08 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +3 Query: 54 FALLTGCNNNCDVACCYCDIRKQPPLCLQCCEEGP 158 + +TGCNN+CD ACC CDI KQPPLC+ CC E P Sbjct: 43 YVTITGCNNDCDTACCNCDISKQPPLCVLCCREDP 77 >gb|EPS71790.1| hypothetical protein M569_02970 [Genlisea aurea] Length = 124 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = +3 Query: 42 TKNIFALLTGCNNNCDVACCYCDIRKQPPLCLQCCEEGP 158 +K +FA C+N+CD ACCYCDI +Q PLC++CC P Sbjct: 89 SKTVFA---ACHNDCDTACCYCDIARQQPLCMRCCGGEP 124