BLASTX nr result
ID: Rauwolfia21_contig00045074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00045074 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607269.1| UDP-glucoronosyl/UDP-glucosyl transferase fa... 75 7e-12 ref|XP_004295933.1| PREDICTED: putative pentatricopeptide repeat... 72 1e-10 gb|EMJ09562.1| hypothetical protein PRUPE_ppa001204mg [Prunus pe... 72 1e-10 ref|XP_004505699.1| PREDICTED: putative pentatricopeptide repeat... 69 5e-10 ref|XP_006592041.1| PREDICTED: putative pentatricopeptide repeat... 68 1e-09 ref|XP_006590792.1| PREDICTED: putative pentatricopeptide repeat... 68 1e-09 ref|XP_004147277.1| PREDICTED: putative pentatricopeptide repeat... 65 1e-08 gb|ESW03597.1| hypothetical protein PHAVU_011G027200g [Phaseolus... 63 5e-08 emb|CBI16176.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat... 63 5e-08 gb|EXC51944.1| hypothetical protein L484_000629 [Morus notabilis] 59 5e-07 ref|XP_004251458.1| PREDICTED: putative pentatricopeptide repeat... 59 5e-07 ref|XP_006363385.1| PREDICTED: putative pentatricopeptide repeat... 59 9e-07 ref|XP_006363384.1| PREDICTED: putative pentatricopeptide repeat... 59 9e-07 gb|EXC46504.1| hypothetical protein L484_000619 [Morus notabilis] 57 2e-06 ref|XP_006488278.1| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 ref|XP_006424773.1| hypothetical protein CICLE_v10027786mg [Citr... 57 3e-06 ref|XP_002532754.1| pentatricopeptide repeat-containing protein,... 56 6e-06 >ref|XP_003607269.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like protein [Medicago truncatula] gi|355508324|gb|AES89466.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like protein [Medicago truncatula] Length = 970 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/76 (52%), Positives = 50/76 (65%) Frame = +1 Query: 52 RHRRPFSTNPIPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSISA 231 RH R + P R S S ST +ND +FI+ ++DIVRG SWK+AFN+PSIS+ Sbjct: 4 RHLRRARLSLSPLQRTFSTSK-----STNENDTHFITHISDIVRGNLSWKIAFNDPSISS 58 Query: 232 NLKPHHVECVLISNLH 279 LKPHHVE VLI+ LH Sbjct: 59 TLKPHHVEQVLINTLH 74 >ref|XP_004295933.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Fragaria vesca subsp. vesca] Length = 904 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 5/77 (6%) Frame = +1 Query: 61 RPFSTNPIPSVREL-----SASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSI 225 RP + P P + + ++S P P+ + ++D +FIS ++D+VRGKQSW++A ++P I Sbjct: 5 RPRRSLPNPLLHSIPRNLSTSSNPTPKDNDENDDAHFISNLSDVVRGKQSWRIALSDPFI 64 Query: 226 SANLKPHHVECVLISNL 276 SA+LKPHHVE VLI N+ Sbjct: 65 SASLKPHHVEKVLIQNV 81 >gb|EMJ09562.1| hypothetical protein PRUPE_ppa001204mg [Prunus persica] Length = 881 Score = 71.6 bits (174), Expect = 1e-10 Identities = 38/77 (49%), Positives = 52/77 (67%), Gaps = 2/77 (2%) Frame = +1 Query: 52 RHRRPFSTNPIPSVRE--LSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSI 225 R RP + + I S S+S P Q + ++D +F+S+++D+VRGKQSWKVAFN+P I Sbjct: 5 RPHRPLTNSIIHSKPRNICSSSKPTSQDNDENDDSHFVSSLSDVVRGKQSWKVAFNDPFI 64 Query: 226 SANLKPHHVECVLISNL 276 S LK HHVE VLI N+ Sbjct: 65 SIALKSHHVEKVLIQNV 81 >ref|XP_004505699.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Cicer arietinum] Length = 886 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 5/67 (7%) Frame = +1 Query: 91 VRELSASPPLPQ-YST----YDNDENFISTVNDIVRGKQSWKVAFNNPSISANLKPHHVE 255 +R+LS +P L +ST ++ND FIS +++IVRG SW VAFN+PSIS+ LKPHHVE Sbjct: 3 LRQLSITPFLQNNFSTSKFNHENDTRFISLISNIVRGNLSWNVAFNDPSISSTLKPHHVE 62 Query: 256 CVLISNL 276 VLI+ L Sbjct: 63 RVLINTL 69 >ref|XP_006592041.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like isoform X1 [Glycine max] gi|571491781|ref|XP_006592042.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like isoform X2 [Glycine max] Length = 903 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/70 (54%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = +1 Query: 70 STNPIPSV-RELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSISANLKPH 246 +T PS+ R SAS P +ND F+S + DIVRGKQSWKVAFN+ SIS+ L+PH Sbjct: 16 TTTTAPSLHRHFSASKP-----DEENDCRFVSLLCDIVRGKQSWKVAFNDASISSTLRPH 70 Query: 247 HVECVLISNL 276 HVE VL++ L Sbjct: 71 HVEQVLMNTL 80 >ref|XP_006590792.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Glycine max] Length = 900 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/61 (59%), Positives = 43/61 (70%) Frame = +1 Query: 94 RELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLISN 273 R SAS P Q ND F+S + DIVRGKQSWKVAFN+ SIS+ L+PHHVE VL++ Sbjct: 22 RHFSASKPDDQ-----NDGRFVSLLCDIVRGKQSWKVAFNDASISSTLRPHHVEQVLMNT 76 Query: 274 L 276 L Sbjct: 77 L 77 >ref|XP_004147277.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Cucumis sativus] gi|449501214|ref|XP_004161309.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Cucumis sativus] Length = 908 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +1 Query: 139 DNDENFISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLISNL 276 +ND +F+ + IVRG QSWK+AFNN SIS N++PHHVE VLI L Sbjct: 35 ENDSHFVYVLEQIVRGNQSWKIAFNNSSISGNIEPHHVEKVLIRTL 80 >gb|ESW03597.1| hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris] Length = 900 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/80 (43%), Positives = 49/80 (61%) Frame = +1 Query: 37 RLHQHRHRRPFSTNPIPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNN 216 +L R P + P + L ++ L +ND +F+S + DIVRGKQSWKVA ++ Sbjct: 2 KLRVVRAALPAAATTTPFLHRLFSASKLDD----ENDGHFVSLLCDIVRGKQSWKVALSD 57 Query: 217 PSISANLKPHHVECVLISNL 276 SIS+ L+PHHVE VLI+ L Sbjct: 58 ASISSALRPHHVEQVLINTL 77 >emb|CBI16176.3| unnamed protein product [Vitis vinifera] Length = 819 Score = 62.8 bits (151), Expect = 5e-08 Identities = 38/77 (49%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +1 Query: 52 RHRRPFSTNP--IPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSI 225 RHR P TNP + R ASP D F++ + DIVRG QSW+VA NN I Sbjct: 5 RHR-PHLTNPNFLRKQRTFCASP----------DSQFVACLTDIVRGNQSWRVALNNSFI 53 Query: 226 SANLKPHHVECVLISNL 276 S LKPHHVE VLI L Sbjct: 54 SQTLKPHHVEKVLIQTL 70 >ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vitis vinifera] Length = 900 Score = 62.8 bits (151), Expect = 5e-08 Identities = 38/77 (49%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +1 Query: 52 RHRRPFSTNP--IPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSI 225 RHR P TNP + R ASP D F++ + DIVRG QSW+VA NN I Sbjct: 5 RHR-PHLTNPNFLRKQRTFCASP----------DSQFVACLTDIVRGNQSWRVALNNSFI 53 Query: 226 SANLKPHHVECVLISNL 276 S LKPHHVE VLI L Sbjct: 54 SQTLKPHHVEKVLIQTL 70 >gb|EXC51944.1| hypothetical protein L484_000629 [Morus notabilis] Length = 910 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 3/56 (5%) Frame = +1 Query: 118 LPQYSTYDNDEN---FISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLISNL 276 LP+ DNDEN F+S ++ IVRG QSWK A ++ ISA LKPHHVE +LI L Sbjct: 25 LPKSLAGDNDENDSHFVSILSGIVRGNQSWKTALDDAFISATLKPHHVEKLLIRTL 80 >ref|XP_004251458.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Solanum lycopersicum] Length = 891 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/86 (40%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Frame = +1 Query: 22 MKPINRLHQH-RHRRPFSTNPIPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSW 198 M P R H RHRR ST +++ ND+NFI+T+N+IVR K+SW Sbjct: 1 MNPSLRRSWHIRHRRTISTTR--------------KFNNQGNDKNFIATLNEIVRSKRSW 46 Query: 199 KVAFNNPSISANLKPHHVECVLISNL 276 +A N+ +IS LK HHVE +L+ L Sbjct: 47 NIALNS-TISTRLKSHHVEQILLQTL 71 >ref|XP_006363385.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like isoform X2 [Solanum tuberosum] Length = 839 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/75 (42%), Positives = 44/75 (58%) Frame = +1 Query: 52 RHRRPFSTNPIPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSISA 231 RHRR ST +++ ND+NFI+T+N+IVR K+SW +A N+ +IS Sbjct: 16 RHRRTISTTR--------------KFNNQGNDKNFIATLNEIVRSKRSWNIALNS-TIST 60 Query: 232 NLKPHHVECVLISNL 276 LK HHVE +LI L Sbjct: 61 RLKNHHVEQILIQTL 75 >ref|XP_006363384.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like isoform X1 [Solanum tuberosum] Length = 894 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/75 (42%), Positives = 44/75 (58%) Frame = +1 Query: 52 RHRRPFSTNPIPSVRELSASPPLPQYSTYDNDENFISTVNDIVRGKQSWKVAFNNPSISA 231 RHRR ST +++ ND+NFI+T+N+IVR K+SW +A N+ +IS Sbjct: 16 RHRRTISTTR--------------KFNNQGNDKNFIATLNEIVRSKRSWNIALNS-TIST 60 Query: 232 NLKPHHVECVLISNL 276 LK HHVE +LI L Sbjct: 61 RLKNHHVEQILIQTL 75 >gb|EXC46504.1| hypothetical protein L484_000619 [Morus notabilis] Length = 955 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Frame = +1 Query: 118 LPQYSTYDNDEN---FISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLISNL 276 LP+ DNDEN F+S ++ IVRG QSWK A ++ SA LKPHHVE +LI L Sbjct: 70 LPKSLAGDNDENDSHFVSILSGIVRGNQSWKTALDDAFTSATLKPHHVEKLLIRTL 125 >ref|XP_006488278.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Citrus sinensis] Length = 890 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +1 Query: 121 PQYSTYDNDEN-FISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLISNL 276 P YS D E+ FI T+ I+RGKQSWK+A ++ +S LKPHHVE VLI L Sbjct: 27 PFYSDNDEKESQFIDTLKKIIRGKQSWKLALDDAVLSTALKPHHVEKVLIQTL 79 >ref|XP_006424773.1| hypothetical protein CICLE_v10027786mg [Citrus clementina] gi|557526707|gb|ESR38013.1| hypothetical protein CICLE_v10027786mg [Citrus clementina] Length = 890 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +1 Query: 121 PQYSTYDNDEN-FISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLISNL 276 P YS D E+ FI T+ I+RGKQSWK+A ++ +S LKPHHVE VLI L Sbjct: 27 PFYSDNDEKESQFIDTLKKIIRGKQSWKLALDDAVLSTALKPHHVEKVLIRTL 79 >ref|XP_002532754.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527505|gb|EEF29631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 721 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +1 Query: 145 DENFISTVNDIVRGKQSWKVAFNNPSISANLKPHHVECVLI 267 D FIS + I+RGKQSW++AFN+P IS NLKP HV+ VL+ Sbjct: 37 DFQFISILTSILRGKQSWRIAFNDPFISRNLKPSHVDKVLM 77