BLASTX nr result
ID: Rauwolfia21_contig00043650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00043650 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citr... 55 1e-05 >ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] gi|557535217|gb|ESR46335.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] Length = 363 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = +1 Query: 31 QNTYPDTIDSREASRRYGKLQSPAGEEEKYKGTISSKDAVVKYNGTLV 174 ++ Y TIDSREA+RRYG L S EE+Y GTI S++A KY GT V Sbjct: 316 RDDYGQTIDSREAARRYGNLGSSPVPEERYTGTIDSREAARKYRGTTV 363