BLASTX nr result
ID: Rauwolfia21_contig00042448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00042448 (248 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139612.1| PREDICTED: uncharacterized protein LOC101217... 57 3e-06 >ref|XP_004139612.1| PREDICTED: uncharacterized protein LOC101217424 [Cucumis sativus] gi|449505598|ref|XP_004162517.1| PREDICTED: uncharacterized LOC101217424 [Cucumis sativus] Length = 184 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/30 (70%), Positives = 29/30 (96%) Frame = -2 Query: 247 HKGASCYFNSAAVLTALNPSHGPCQFEFIP 158 HKGA+CYFNSAA++T+L+PSHG C+FE++P Sbjct: 155 HKGATCYFNSAAMVTSLDPSHGSCKFEYVP 184