BLASTX nr result
ID: Rauwolfia21_contig00041955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00041955 (631 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK30294.1|AF353207_1 beta-amylase [Castanea crenata] 64 4e-08 ref|XP_006447463.1| hypothetical protein CICLE_v10014929mg [Citr... 57 4e-06 ref|XP_006360578.1| PREDICTED: beta-amylase-like [Solanum tubero... 56 1e-05 >gb|AAK30294.1|AF353207_1 beta-amylase [Castanea crenata] Length = 514 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = -3 Query: 599 PLEQSRPKIPIQELLEATKPIMPFPWDQAPDICVRGTFSEIFESIFNVF 453 PLE+S+PK+PI+ LLEAT+P+ PFPWD+ D+ V G S + + IF++F Sbjct: 465 PLERSKPKMPIEYLLEATEPMEPFPWDKETDMSVGGALSNLIDKIFSIF 513 >ref|XP_006447463.1| hypothetical protein CICLE_v10014929mg [Citrus clementina] gi|568830923|ref|XP_006469732.1| PREDICTED: beta-amylase-like [Citrus sinensis] gi|557550074|gb|ESR60703.1| hypothetical protein CICLE_v10014929mg [Citrus clementina] Length = 519 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/55 (45%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = -3 Query: 608 KLEPLEQSRPKIPIQELLEATKPIMPFPWDQAPDICV---RGTFSEIFESIFNVF 453 +++PLE+S+PK +EL+EATK ++PFPWD+ D+ V RG + +F IF++F Sbjct: 464 EIDPLERSKPKFSNEELMEATKKLLPFPWDEETDMNVGGTRGILAALFGKIFSMF 518 >ref|XP_006360578.1| PREDICTED: beta-amylase-like [Solanum tuberosum] Length = 578 Score = 55.8 bits (133), Expect = 1e-05 Identities = 25/60 (41%), Positives = 37/60 (61%) Frame = -3 Query: 629 DFIPNYIKLEPLEQSRPKIPIQELLEATKPIMPFPWDQAPDICVRGTFSEIFESIFNVFF 450 D+ P Y K PL +S+ +I + ELLEAT+ PFPWD+ D + G +E ++ + N FF Sbjct: 516 DYCPEYEKPAPLGRSKGEISMDELLEATQRTKPFPWDEQTDARIGGILAEYWDRLLNKFF 575