BLASTX nr result
ID: Rauwolfia21_contig00041523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00041523 (283 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40653.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002272111.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protei... 67 2e-09 ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Caps... 67 2e-09 ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus pe... 67 2e-09 ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containi... 66 5e-09 ref|XP_002892635.1| pentatricopeptide repeat-containing protein ... 66 5e-09 ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|NP_172596.1| pentatricopeptide repeat-containing protein [Ar... 65 7e-09 ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 gb|ESW20787.1| hypothetical protein PHAVU_005G014800g [Phaseolus... 64 2e-08 ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 2e-08 ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004233812.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006363206.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] 63 5e-08 >emb|CBI40653.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVTK EIIVRDM RFHHF++GTCSCGDYW Sbjct: 563 ATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 597 >ref|XP_002272111.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Length = 849 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVTK EIIVRDM RFHHF++GTCSCGDYW Sbjct: 815 ATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 849 >gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 886 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRDM RFHHF+NGTCSCGDYW Sbjct: 852 ATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 886 >ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] gi|482573205|gb|EOA37392.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] Length = 811 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT+ EIIVRDM RFHHF+NG CSCGDYW Sbjct: 777 ATKYISLVTRREIIVRDMQRFHHFKNGVCSCGDYW 811 >ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Fragaria vesca subsp. vesca] Length = 827 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRDM RFHHF+NGTCSCGDYW Sbjct: 793 ATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] Length = 827 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRDM RFHHF+NGTCSCGDYW Sbjct: 793 ATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum tuberosum] Length = 809 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLV K EIIVRDM RFHHF+NG CSCGDYW Sbjct: 775 ATKYISLVMKREIIVRDMHRFHHFKNGVCSCGDYW 809 >ref|XP_002892635.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338477|gb|EFH68894.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 809 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRDM RFHHF+NG CSCGDYW Sbjct: 775 ATKYISLVTGREIIVRDMQRFHHFKNGACSCGDYW 809 >ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRDM RFHHF+NG CSCGDYW Sbjct: 787 ATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRDM RFHHF+NG CSCGDYW Sbjct: 787 ATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|NP_172596.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122213654|sp|Q3E6Q1.1|PPR32_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g11290 gi|332190592|gb|AEE28713.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 809 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EI+VRDM RFHHF+NG CSCGDYW Sbjct: 775 ATKYISLVTGREIVVRDMQRFHHFKNGACSCGDYW 809 >ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cicer arietinum] Length = 814 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRD+ RFHHF+NG+CSCGDYW Sbjct: 780 ATKYISLVTGREIIVRDLQRFHHFKNGSCSCGDYW 814 >gb|ESW20787.1| hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] Length = 807 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRD+ RFHHF+NG CSCGDYW Sbjct: 773 ATKYISLVTGREIIVRDLRRFHHFKNGNCSCGDYW 807 >ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 A KCIS +T+ EI++RD RFHHFRNGTCSCGDYW Sbjct: 1539 AIKCISKLTQREIVLRDANRFHHFRNGTCSCGDYW 1573 >ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 A KCIS +T+ EI++RD RFHHFRNGTCSCGDYW Sbjct: 1539 AIKCISKLTQREIVLRDANRFHHFRNGTCSCGDYW 1573 >ref|XP_004233812.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum lycopersicum] Length = 811 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLV K EIIVRDM RFHHF++G CSCGDYW Sbjct: 777 ATKYISLVMKREIIVRDMHRFHHFKDGVCSCGDYW 811 >ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 816 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLVT EIIVRD+ RFHHF+NG CSCGDYW Sbjct: 782 ATKYISLVTGREIIVRDLRRFHHFKNGICSCGDYW 816 >ref|XP_006363206.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Solanum tuberosum] Length = 889 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK IS + EIIVRD+ RFHHFRNGTCSCGDYW Sbjct: 855 ATKFISKIVNREIIVRDVRRFHHFRNGTCSCGDYW 889 >ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 818 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 6 TKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 TK ISLVT EIIVRD+ RFHHF+NG+CSCGDYW Sbjct: 785 TKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 818 >gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] Length = 814 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 ATKCISLVTKWEIIVRDMPRFHHFRNGTCSCGDYW 107 ATK ISLV+ EIIVRDM RFH F+NGTCSCGDYW Sbjct: 780 ATKYISLVSGREIIVRDMHRFHQFKNGTCSCGDYW 814