BLASTX nr result
ID: Rauwolfia21_contig00040709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00040709 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517341.1| catalytic, putative [Ricinus communis] gi|22... 63 5e-08 ref|XP_004171063.1| PREDICTED: protein SAMHD1 homolog, partial [... 61 1e-07 ref|XP_004141086.1| PREDICTED: protein SAMHD1 homolog [Cucumis s... 61 1e-07 ref|XP_002312899.1| hypothetical protein POPTR_0009s15000g [Popu... 61 2e-07 gb|EMJ18542.1| hypothetical protein PRUPE_ppa019164mg [Prunus pe... 60 3e-07 gb|EOY00448.1| HD domain-containing metal-dependent phosphohydro... 59 5e-07 gb|EOY00447.1| HD domain-containing metal-dependent phosphohydro... 59 5e-07 ref|XP_002264209.2| PREDICTED: uncharacterized protein LOC100267... 59 7e-07 emb|CBI32143.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_004967966.1| PREDICTED: protein SAMHD1 homolog isoform X2... 59 9e-07 ref|XP_004967965.1| PREDICTED: protein SAMHD1 homolog isoform X1... 59 9e-07 ref|XP_002278629.1| PREDICTED: protein SAMHD1 homolog [Vitis vin... 59 9e-07 ref|XP_002525389.1| catalytic, putative [Ricinus communis] gi|22... 59 9e-07 emb|CAN60344.1| hypothetical protein VITISV_017021 [Vitis vinifera] 59 9e-07 ref|XP_006380017.1| hypothetical protein POPTR_0008s19450g [Popu... 58 1e-06 ref|XP_002311778.1| hypothetical protein POPTR_0008s19450g [Popu... 58 1e-06 gb|EEE53728.1| hypothetical protein OsJ_00074 [Oryza sativa Japo... 58 1e-06 gb|EEC69794.1| hypothetical protein OsI_00082 [Oryza sativa Indi... 58 1e-06 ref|XP_001775560.1| predicted protein [Physcomitrella patens] gi... 58 1e-06 gb|EMT23168.1| SAM domain and HD domain-containing protein 1 [Ae... 58 1e-06 >ref|XP_002517341.1| catalytic, putative [Ricinus communis] gi|223543352|gb|EEF44883.1| catalytic, putative [Ricinus communis] Length = 421 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEY+VPKD+LENFKDVTAQDIVCSQ Sbjct: 336 LYQFCNEYAVPKDKLENFKDVTAQDIVCSQ 365 >ref|XP_004171063.1| PREDICTED: protein SAMHD1 homolog, partial [Cucumis sativus] Length = 405 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEY+VPKD+LENFKDVTA+DIVCSQ Sbjct: 336 LYQFCNEYAVPKDKLENFKDVTAKDIVCSQ 365 >ref|XP_004141086.1| PREDICTED: protein SAMHD1 homolog [Cucumis sativus] Length = 471 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEY+VPKD+LENFKDVTA+DIVCSQ Sbjct: 336 LYQFCNEYAVPKDKLENFKDVTAKDIVCSQ 365 >ref|XP_002312899.1| hypothetical protein POPTR_0009s15000g [Populus trichocarpa] gi|222849307|gb|EEE86854.1| hypothetical protein POPTR_0009s15000g [Populus trichocarpa] Length = 477 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEY+VP+D++ENFKDVTAQDIVCSQ Sbjct: 340 LYQFCNEYAVPRDKIENFKDVTAQDIVCSQ 369 >gb|EMJ18542.1| hypothetical protein PRUPE_ppa019164mg [Prunus persica] Length = 474 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEY+VPKD++ENFK+VTAQDIVCSQ Sbjct: 335 LYQFCNEYAVPKDKMENFKNVTAQDIVCSQ 364 >gb|EOY00448.1| HD domain-containing metal-dependent phosphohydrolase family protein isoform 2 [Theobroma cacao] Length = 424 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEYSVPKD+ ENFKD+T QDIVCSQ Sbjct: 333 LYQFCNEYSVPKDKQENFKDITPQDIVCSQ 362 >gb|EOY00447.1| HD domain-containing metal-dependent phosphohydrolase family protein isoform 1 [Theobroma cacao] Length = 468 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEYSVPKD+ ENFKD+T QDIVCSQ Sbjct: 333 LYQFCNEYSVPKDKQENFKDITPQDIVCSQ 362 >ref|XP_002264209.2| PREDICTED: uncharacterized protein LOC100267261 [Vitis vinifera] Length = 907 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNE+SVPKDRLE+FKD+T QDI+CSQ Sbjct: 719 LYQFCNEFSVPKDRLEHFKDITPQDIICSQ 748 >emb|CBI32143.3| unnamed protein product [Vitis vinifera] Length = 473 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNE+SVPKDRLE+FKD+T QDI+CSQ Sbjct: 332 LYQFCNEFSVPKDRLEHFKDITPQDIICSQ 361 >ref|XP_004967966.1| PREDICTED: protein SAMHD1 homolog isoform X2 [Setaria italica] Length = 494 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L++FCNEYSVPKD+LE+FK+VTAQDIVCSQ Sbjct: 359 LYKFCNEYSVPKDKLEHFKNVTAQDIVCSQ 388 >ref|XP_004967965.1| PREDICTED: protein SAMHD1 homolog isoform X1 [Setaria italica] Length = 495 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L++FCNEYSVPKD+LE+FK+VTAQDIVCSQ Sbjct: 359 LYKFCNEYSVPKDKLEHFKNVTAQDIVCSQ 388 >ref|XP_002278629.1| PREDICTED: protein SAMHD1 homolog [Vitis vinifera] gi|296087679|emb|CBI34935.3| unnamed protein product [Vitis vinifera] Length = 467 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L++FCNEY+VP+D+LENFKDVT QDIVCSQ Sbjct: 333 LYRFCNEYAVPRDKLENFKDVTVQDIVCSQ 362 >ref|XP_002525389.1| catalytic, putative [Ricinus communis] gi|223535352|gb|EEF37027.1| catalytic, putative [Ricinus communis] Length = 861 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNE+SVPKD+LE+FKDVT QDIVCSQ Sbjct: 719 LYQFCNEFSVPKDKLEHFKDVTPQDIVCSQ 748 >emb|CAN60344.1| hypothetical protein VITISV_017021 [Vitis vinifera] Length = 600 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L++FCNEY+VP+D+LENFKDVT QDIVCSQ Sbjct: 324 LYRFCNEYAVPRDKLENFKDVTVQDIVCSQ 353 >ref|XP_006380017.1| hypothetical protein POPTR_0008s19450g [Populus trichocarpa] gi|550333469|gb|ERP57814.1| hypothetical protein POPTR_0008s19450g [Populus trichocarpa] Length = 469 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNE+SVPKD+LE+FKD+T QDIVCSQ Sbjct: 328 LYQFCNEFSVPKDKLEHFKDITPQDIVCSQ 357 >ref|XP_002311778.1| hypothetical protein POPTR_0008s19450g [Populus trichocarpa] gi|222851598|gb|EEE89145.1| hypothetical protein POPTR_0008s19450g [Populus trichocarpa] Length = 469 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNE+SVPKD+LE+FKD+T QDIVCSQ Sbjct: 328 LYQFCNEFSVPKDKLEHFKDITPQDIVCSQ 357 >gb|EEE53728.1| hypothetical protein OsJ_00074 [Oryza sativa Japonica Group] Length = 502 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L++FCNEYSVPKD+LE+FK++TAQDIVCSQ Sbjct: 360 LYKFCNEYSVPKDKLEHFKNITAQDIVCSQ 389 >gb|EEC69794.1| hypothetical protein OsI_00082 [Oryza sativa Indica Group] Length = 496 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L++FCNEYSVPKD+LE+FK++TAQDIVCSQ Sbjct: 360 LYKFCNEYSVPKDKLEHFKNITAQDIVCSQ 389 >ref|XP_001775560.1| predicted protein [Physcomitrella patens] gi|162673115|gb|EDQ59643.1| predicted protein [Physcomitrella patens] Length = 464 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 90 LWQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 L+QFCNEY+VPK+ LE+FKDVTAQDI+CSQ Sbjct: 328 LYQFCNEYAVPKEHLEHFKDVTAQDIICSQ 357 >gb|EMT23168.1| SAM domain and HD domain-containing protein 1 [Aegilops tauschii] Length = 416 Score = 57.8 bits (138), Expect = 1e-06 Identities = 22/29 (75%), Positives = 29/29 (100%) Frame = -2 Query: 87 WQFCNEYSVPKDRLENFKDVTAQDIVCSQ 1 W+FCN+YSVPKD+L++FK++TAQDIVCSQ Sbjct: 281 WKFCNQYSVPKDKLDHFKNITAQDIVCSQ 309