BLASTX nr result
ID: Rauwolfia21_contig00040686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00040686 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 115 5e-24 ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 114 2e-23 ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-23 ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citr... 113 3e-23 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 112 5e-23 ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 gb|EOY30985.1| Pentatricopeptide repeat-containing protein, puta... 111 1e-22 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 109 4e-22 gb|ESW26970.1| hypothetical protein PHAVU_003G162300g [Phaseolus... 108 7e-22 ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago t... 108 7e-22 gb|EMJ05156.1| hypothetical protein PRUPE_ppa022872mg [Prunus pe... 107 2e-21 ref|XP_004508527.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_003525660.2| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 103 2e-20 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 gb|EOX96932.1| Tetratricopeptide repeat (TPR)-like superfamily p... 101 1e-19 ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 115 bits (289), Expect = 5e-24 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +P TT+RI+KNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHF+DGSCSCMDYW Sbjct: 684 KPETTIRIVKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 738 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 114 bits (284), Expect = 2e-23 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFNREIIARDRNRFHHF+DGSCSC DYW Sbjct: 682 KPGTTIRIMKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCKDYW 736 >ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 736 Score = 113 bits (282), Expect = 3e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFNREIIARDRNRFHHF+DG+CSC DYW Sbjct: 682 KPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGNCSCNDYW 736 >ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] gi|557554208|gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] Length = 736 Score = 113 bits (282), Expect = 3e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFNREIIARDRNRFHHF+DG+CSC DYW Sbjct: 682 KPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGNCSCNDYW 736 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 112 bits (280), Expect = 5e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFNREIIARDRNRFHHF++GSCSC DYW Sbjct: 683 KPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKNGSCSCNDYW 737 >ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 731 Score = 112 bits (280), Expect = 5e-23 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTTLRI+KNLRVCGNCH A K+ISKIFNREIIARDRNRFHHF++GSCSC+DYW Sbjct: 677 KPGTTLRIVKNLRVCGNCHEATKMISKIFNREIIARDRNRFHHFKNGSCSCLDYW 731 >gb|EOY30985.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 194 Score = 111 bits (277), Expect = 1e-22 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFN+EIIARDRNRFHHF+DG CSC DYW Sbjct: 140 KPGTTIRIVKNLRVCGNCHSATKLISKIFNKEIIARDRNRFHHFKDGFCSCKDYW 194 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 109 bits (272), Expect = 4e-22 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGT +RIIKNLRVC NCHSA KLISKIFNREIIARDRNRFHHF+DGSCSC DYW Sbjct: 680 KPGTPIRIIKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDYW 734 >gb|ESW26970.1| hypothetical protein PHAVU_003G162300g [Phaseolus vulgaris] Length = 733 Score = 108 bits (270), Expect = 7e-22 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFNREIIARDRNRFHHF+DG CSC D W Sbjct: 679 KPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 733 >ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510321|gb|AES91463.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 738 Score = 108 bits (270), Expect = 7e-22 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVCGNCHSA KLISKIFNREIIARDRNRFHHF+DG CSC D W Sbjct: 684 KPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 738 >gb|EMJ05156.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] Length = 714 Score = 107 bits (266), Expect = 2e-21 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PGTT+RI+KNLRVC NCHSA KLISKIFNREIIARD NRFHHFRDGSCSC D W Sbjct: 660 KPGTTIRIVKNLRVCANCHSATKLISKIFNREIIARDGNRFHHFRDGSCSCNDNW 714 >ref|XP_004508527.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 737 Score = 105 bits (263), Expect = 5e-21 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PG+T+RI+KNLRVCGNCHSA KLISKIFNR+IIARDRNRFHHF+DG CSC D W Sbjct: 683 KPGSTIRIVKNLRVCGNCHSATKLISKIFNRQIIARDRNRFHHFKDGFCSCNDCW 737 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 104 bits (259), Expect = 1e-20 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 RPGTT+R+ KNLRVC +CHSA KLISK++NREI+ RDRNRFHHF+DGSCSC DYW Sbjct: 641 RPGTTIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >ref|XP_003525660.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 737 Score = 103 bits (258), Expect = 2e-20 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 3 RPGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 +PG+T+RI+KNLRVC NCHSA KLISKIFNREIIARDRNRFHHF+DG CSC D W Sbjct: 683 KPGSTIRIVKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDRW 737 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 103 bits (258), Expect = 2e-20 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +3 Query: 6 PGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 PGTT+RI KNLRVC +CHSA KLISKI+NREII RDR RFHHFRDGSCSCMD+W Sbjct: 447 PGTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 500 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 103 bits (258), Expect = 2e-20 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +3 Query: 6 PGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 PGTT+RI KNLRVC +CHSA KLISKI+NREII RDR RFHHFRDGSCSCMD+W Sbjct: 587 PGTTIRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 640 >gb|EOX96932.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705037|gb|EOX96933.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705038|gb|EOX96934.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 616 Score = 101 bits (251), Expect = 1e-19 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = +3 Query: 6 PGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 PGT +R++KNLRVC +CH AIKL+SK+F REII RDR+RFHHFR+GSCSCMDYW Sbjct: 563 PGTPIRVVKNLRVCADCHMAIKLLSKVFKREIIIRDRSRFHHFRNGSCSCMDYW 616 >ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 625 Score = 100 bits (250), Expect = 2e-19 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +3 Query: 6 PGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 PGT LR+ KNLR+CG+CH+AIKL+SKI+ REII RD NRFHHF+DGSCSC DYW Sbjct: 572 PGTVLRVTKNLRICGDCHTAIKLVSKIYEREIIVRDVNRFHHFKDGSCSCRDYW 625 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 100 bits (249), Expect = 2e-19 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +3 Query: 6 PGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 PGT +RI+KNLRVCG+CH AIKLISKI++REII RDR+RFHHF+ GSCSC DYW Sbjct: 541 PGTPIRIVKNLRVCGDCHMAIKLISKIYDREIIVRDRSRFHHFKGGSCSCKDYW 594 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 100 bits (249), Expect = 2e-19 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = +3 Query: 6 PGTTLRIIKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFRDGSCSCMDYW 167 PGTT+R++KNLRVC +CH+A KLISK++NREII RDRNRFH F+DGSCSC D+W Sbjct: 606 PGTTIRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDGSCSCKDFW 659