BLASTX nr result
ID: Rauwolfia21_contig00040164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00040164 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73892.1| hypothetical protein M569_00859, partial [Genlise... 62 8e-08 ref|XP_003610132.1| Mitochondrial chaperone BCS1 [Medicago trunc... 55 1e-05 gb|ACJ85627.1| unknown [Medicago truncatula] gi|388509064|gb|AFK... 55 1e-05 >gb|EPS73892.1| hypothetical protein M569_00859, partial [Genlisea aurea] Length = 509 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 289 MKEFWTTLASVMGVWAFFQSILHTVFPPEL 378 MKE WTT+AS+MGVWAFFQS+LHTVFPPEL Sbjct: 1 MKEIWTTVASMMGVWAFFQSLLHTVFPPEL 30 >ref|XP_003610132.1| Mitochondrial chaperone BCS1 [Medicago truncatula] gi|355511187|gb|AES92329.1| Mitochondrial chaperone BCS1 [Medicago truncatula] Length = 521 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 289 MKEFWTTLASVMGVWAFFQSILHTVFPPEL 378 MKE+WT+LAS++GV+AFFQ+IL TVFPPEL Sbjct: 1 MKEYWTSLASILGVFAFFQTILQTVFPPEL 30 >gb|ACJ85627.1| unknown [Medicago truncatula] gi|388509064|gb|AFK42598.1| unknown [Medicago truncatula] Length = 521 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 289 MKEFWTTLASVMGVWAFFQSILHTVFPPEL 378 MKE+WT+LAS++GV+AFFQ+IL TVFPPEL Sbjct: 1 MKEYWTSLASILGVFAFFQTILQTVFPPEL 30