BLASTX nr result
ID: Rauwolfia21_contig00040016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00040016 (946 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518536.1| tyrosyl-DNA phosphodiesterase, putative [Ric... 58 5e-06 >ref|XP_002518536.1| tyrosyl-DNA phosphodiesterase, putative [Ricinus communis] gi|223542381|gb|EEF43923.1| tyrosyl-DNA phosphodiesterase, putative [Ricinus communis] Length = 665 Score = 58.2 bits (139), Expect = 5e-06 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = +3 Query: 813 SGLYCSLPFLLKTVRFN----RWLLLTSANLSKAAWGALQKNNSQLMI 944 SG ++P + R+N WLLLTSANLSKAAWGALQKNNSQLMI Sbjct: 507 SGRCRAMPHIKTFTRYNGQKLAWLLLTSANLSKAAWGALQKNNSQLMI 554