BLASTX nr result
ID: Rauwolfia21_contig00039890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00039890 (491 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263160.1| PREDICTED: adenylate kinase [Vitis vinifera]... 68 1e-09 ref|XP_006374659.1| hypothetical protein POPTR_0015s14610g [Popu... 59 9e-07 >ref|XP_002263160.1| PREDICTED: adenylate kinase [Vitis vinifera] gi|296084179|emb|CBI24567.3| unnamed protein product [Vitis vinifera] Length = 238 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = -1 Query: 176 MWRRLTSLSPLFSASKPSIFSQAACGMRICQLLGTEVHIPVEDGTSSRETTPFVTFVL 3 MWRR+TSLSP S+SKPSI +QA+ G +I +L TE+ P + G SS E TPF+TFV+ Sbjct: 1 MWRRVTSLSPFISSSKPSIRNQASYGGKIWELFTTEILTPAKAGISSDEKTPFITFVV 58 >ref|XP_006374659.1| hypothetical protein POPTR_0015s14610g [Populus trichocarpa] gi|550322720|gb|ERP52456.1| hypothetical protein POPTR_0015s14610g [Populus trichocarpa] Length = 239 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = -1 Query: 176 MWRRLTSLSPLFSASKPSIFSQAACGMRICQ-LLGTEVHIPVEDGTSS-RETTPFVTFVL 3 MWRR+TSLSP+ S SKP+ QAA G +I + TE V+DGT+S +E PF+TFVL Sbjct: 1 MWRRVTSLSPVMSTSKPTSLDQAASGFKIWRSSFSTETPTLVKDGTTSFKERNPFITFVL 60