BLASTX nr result
ID: Rauwolfia21_contig00039302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00039302 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37867.1| WRKY transcription factor 6 [Morus notabilis] 58 1e-06 >gb|EXB37867.1| WRKY transcription factor 6 [Morus notabilis] Length = 600 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +1 Query: 115 MAKGSGLSFDPDRIGLFLHKPTVINSFQDDR---TNHHHL 225 MAKGSGLS D D IGLF+HKPTV+NSFQ D+ NHH++ Sbjct: 1 MAKGSGLSIDSDPIGLFIHKPTVLNSFQQDQDYNNNHHNI 40