BLASTX nr result
ID: Rauwolfia21_contig00039257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00039257 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571092.1| PREDICTED: isoflavone 2'-hydroxylase-like [B... 59 5e-07 >ref|XP_003571092.1| PREDICTED: isoflavone 2'-hydroxylase-like [Brachypodium distachyon] Length = 525 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 327 IGPELVDMEEGSGLVLPKLKPLEAFYKPRPRAQHLISHV 211 +G ELVDM EGSGL +PKL PLEAFY+PRP HL+S + Sbjct: 487 VGEELVDMAEGSGLTMPKLVPLEAFYQPRPSMLHLLSEI 525