BLASTX nr result
ID: Rauwolfia21_contig00038389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00038389 (600 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362192.1| PREDICTED: putative ion channel POLLUX-like ... 57 5e-06 ref|XP_004247688.1| PREDICTED: putative ion channel POLLUX-like ... 57 5e-06 >ref|XP_006362192.1| PREDICTED: putative ion channel POLLUX-like 2-like [Solanum tuberosum] Length = 847 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 508 EILSDVPMDDRNKASKLAGQGKLKNVHVSHR 600 E+LSDVPMDDR+ AS+LAGQGKLKNV VSHR Sbjct: 619 EVLSDVPMDDRHTASRLAGQGKLKNVRVSHR 649 >ref|XP_004247688.1| PREDICTED: putative ion channel POLLUX-like 2-like [Solanum lycopersicum] Length = 847 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 508 EILSDVPMDDRNKASKLAGQGKLKNVHVSHR 600 E+LSDVPMDDR+ AS+LAGQGKLKNV VSHR Sbjct: 619 EVLSDVPMDDRHTASRLAGQGKLKNVRVSHR 649