BLASTX nr result
ID: Rauwolfia21_contig00038283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00038283 (726 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281719.2| PREDICTED: pentatricopeptide repeat-containi... 58 4e-06 emb|CBI28142.3| unnamed protein product [Vitis vinifera] 58 4e-06 ref|XP_002529360.1| pentatricopeptide repeat-containing protein,... 57 5e-06 >ref|XP_002281719.2| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Vitis vinifera] Length = 662 Score = 57.8 bits (138), Expect = 4e-06 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = +1 Query: 1 EDVRKVRRKMRGLRIKKSPGCSSIEVDSDIPEVNAGDAFHTAGKESQMMSASRSKPL 171 EDV KVRRKM+ L +KK PGCSS+EV+ + E GDA H +E M S +KPL Sbjct: 588 EDVTKVRRKMKDLGVKKVPGCSSVEVNGIVHEFLVGDASHPEMREIYSMLDSIAKPL 644 >emb|CBI28142.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 57.8 bits (138), Expect = 4e-06 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = +1 Query: 1 EDVRKVRRKMRGLRIKKSPGCSSIEVDSDIPEVNAGDAFHTAGKESQMMSASRSKPL 171 EDV KVRRKM+ L +KK PGCSS+EV+ + E GDA H +E M S +KPL Sbjct: 497 EDVTKVRRKMKDLGVKKVPGCSSVEVNGIVHEFLVGDASHPEMREIYSMLDSIAKPL 553 >ref|XP_002529360.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531180|gb|EEF33027.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 683 Score = 57.4 bits (137), Expect = 5e-06 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = +1 Query: 1 EDVRKVRRKMRGLRIKKSPGCSSIEVDSDIPEVNAGDAFHTAGKESQMMSASRSKPL 171 EDV KVRRKM+ L +KK+PGCSSIEVDS I E +G H +E M +KPL Sbjct: 593 EDVTKVRRKMKDLGVKKTPGCSSIEVDSIIHEFFSGHPSHPEMREIYYMLNIMAKPL 649