BLASTX nr result
ID: Rauwolfia21_contig00038111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00038111 (989 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB59779.1| hypothetical protein L484_010890 [Morus notabilis] 59 2e-06 >gb|EXB59779.1| hypothetical protein L484_010890 [Morus notabilis] Length = 775 Score = 59.3 bits (142), Expect = 2e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -3 Query: 987 LGRWDDAKNVREMMIDRQVTKDPGSSWIEHEKGNTYLYG 871 LGRWD+A+ VR++M D+QV KDPG SWIE++ G+ +YG Sbjct: 736 LGRWDEARGVRDLMKDKQVMKDPGCSWIEYQSGDANIYG 774