BLASTX nr result
ID: Rauwolfia21_contig00037444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00037444 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56667.1| hypothetical protein L484_004272 [Morus notabilis] 55 1e-05 >gb|EXB56667.1| hypothetical protein L484_004272 [Morus notabilis] Length = 339 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 232 VAEACAQLTHEFFTENTLRMLINCLPKLNSE 140 VAEACAQLT EFF ENTLR++I CLPKLN E Sbjct: 64 VAEACAQLTQEFFRENTLRLIIRCLPKLNLE 94