BLASTX nr result
ID: Rauwolfia21_contig00037377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00037377 (644 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172737.1| PREDICTED: probable prefoldin subunit 1-like... 60 4e-07 >ref|XP_004172737.1| PREDICTED: probable prefoldin subunit 1-like [Cucumis sativus] Length = 117 Score = 60.5 bits (145), Expect = 4e-07 Identities = 36/63 (57%), Positives = 40/63 (63%) Frame = -2 Query: 643 FVLEPKSVLMDEQEQKFKDSETAIASLQVYFHLIFHFCSAFVYTLYPVRQGTRTDYFSIT 464 FVLE KSVLM+EQEQKFKDSETAIASLQV+ + F C R GT T F I Sbjct: 65 FVLESKSVLMNEQEQKFKDSETAIASLQVHIKISF-LC----------RDGTSTFLFPIV 113 Query: 463 FLC 455 + C Sbjct: 114 YTC 116