BLASTX nr result
ID: Rauwolfia21_contig00037229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00037229 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC62795.1| contains similarity to retroviral aspartyl protea... 59 7e-07 gb|AAF69161.1|AC007915_13 F27F5.19 [Arabidopsis thaliana] 56 6e-06 >gb|AAC62795.1| contains similarity to retroviral aspartyl proteases (Pfam: rvp.hmm, score: 11.80) [Arabidopsis thaliana] Length = 1244 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -2 Query: 338 CSFCGQLGHTVDRCYKKHGYPPNFKGKKQFNGTANQALA 222 CSFC ++GH ++CYKKHGYPP FKGK GT Q +A Sbjct: 293 CSFCNKVGHIAEKCYKKHGYPPGFKGKLPEKGTKPQPVA 331 >gb|AAF69161.1|AC007915_13 F27F5.19 [Arabidopsis thaliana] Length = 1309 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -2 Query: 359 GGSRVYKCSFCGQLGHTVDRCYKKHGYPPNFK-GKKQFNGTANQA 228 G + KCSFC +LGH VD+CYKKHGYPP K K Q G+ N A Sbjct: 306 GSYKKPKCSFCNKLGHLVDKCYKKHGYPPGSKWTKAQTIGSTNLA 350