BLASTX nr result
ID: Rauwolfia21_contig00037110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00037110 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006590851.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 60 2e-11 tpg|DAA64358.1| TPA: putative peptidyl-prolyl cis-trans isomeras... 67 2e-09 tpg|DAA51917.1| TPA: putative peptidyl-prolyl cis-trans isomeras... 67 2e-09 tpg|DAA64359.1| TPA: putative peptidyl-prolyl cis-trans isomeras... 63 3e-09 ref|XP_004957482.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 3e-09 ref|XP_002460578.1| hypothetical protein SORBIDRAFT_02g031150 [S... 63 3e-09 ref|NP_001136688.1| putative peptidyl-prolyl cis-trans isomerase... 63 3e-09 tpg|DAA64361.1| TPA: putative peptidyl-prolyl cis-trans isomeras... 63 3e-09 ref|XP_004231028.1| PREDICTED: choline transporter-like protein ... 61 5e-09 ref|XP_006359677.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 5e-09 gb|ESW09348.1| hypothetical protein PHAVU_009G120200g [Phaseolus... 62 7e-09 ref|XP_006412168.1| hypothetical protein EUTSA_v10026179mg [Eutr... 62 7e-09 ref|XP_002305507.2| hypothetical protein POPTR_0004s17920g [Popu... 65 7e-09 ref|XP_003537802.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 60 9e-09 ref|NP_001241966.1| uncharacterized protein LOC100808983 [Glycin... 60 9e-09 gb|ACU19139.1| unknown [Glycine max] 60 9e-09 tpg|DAA58192.1| TPA: hypothetical protein ZEAMMB73_458241 [Zea m... 65 1e-08 ref|XP_003578523.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-08 gb|AFW70308.1| putative peptidyl-prolyl cis-trans isomerase fami... 61 2e-08 gb|AFW70307.1| putative peptidyl-prolyl cis-trans isomerase fami... 61 2e-08 >ref|XP_006590851.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform X2 [Glycine max] Length = 220 Score = 60.5 bits (145), Expect(2) = 2e-11 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 GEKGK NG LHYKGTPFHRII GF+I GGDIV+ Sbjct: 81 GEKGKSENGIKLHYKGTPFHRIISGFVIQGGDIVH 115 Score = 33.9 bits (76), Expect(2) = 2e-11 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 DIDKQR+ENFRALCT Sbjct: 66 DIDKQRLENFRALCT 80 >tpg|DAA64358.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 208 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +2 Query: 122 FFLSEAQSFPFHKPGEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 F L A++F GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 54 FVLHSAENFRALCTGEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 101 >tpg|DAA51917.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 650 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +2 Query: 122 FFLSEAQSFPFHKPGEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 F L A++F GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 496 FVLHSAENFRALCTGEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 543 >tpg|DAA64359.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 63.2 bits (152), Expect(2) = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 92 GEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 125 Score = 23.5 bits (49), Expect(2) = 3e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 ++ + VENFRALCT Sbjct: 77 EVVPKTVENFRALCT 91 >ref|XP_004957482.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Setaria italica] Length = 216 Score = 63.2 bits (152), Expect(2) = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 76 GEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 109 Score = 23.5 bits (49), Expect(2) = 3e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 ++ + VENFRALCT Sbjct: 61 EVVPKTVENFRALCT 75 >ref|XP_002460578.1| hypothetical protein SORBIDRAFT_02g031150 [Sorghum bicolor] gi|241923955|gb|EER97099.1| hypothetical protein SORBIDRAFT_02g031150 [Sorghum bicolor] Length = 216 Score = 63.2 bits (152), Expect(2) = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 76 GEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 109 Score = 23.5 bits (49), Expect(2) = 3e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 ++ + VENFRALCT Sbjct: 61 EVVPKTVENFRALCT 75 >ref|NP_001136688.1| putative peptidyl-prolyl cis-trans isomerase family protein precursor [Zea mays] gi|194696648|gb|ACF82408.1| unknown [Zea mays] gi|195658001|gb|ACG48468.1| peptidyl-prolyl cis-trans isomerase CYP19-4 precursor [Zea mays] gi|414888348|tpg|DAA64362.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 216 Score = 63.2 bits (152), Expect(2) = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 76 GEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 109 Score = 23.5 bits (49), Expect(2) = 3e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 ++ + VENFRALCT Sbjct: 61 EVVPKTVENFRALCT 75 >tpg|DAA64361.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 154 Score = 63.2 bits (152), Expect(2) = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKGTPFHRIIPGFMI GGDIV Sbjct: 76 GEKGVGSNGKPLHYKGTPFHRIIPGFMIQGGDIV 109 Score = 23.5 bits (49), Expect(2) = 3e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 ++ + VENFRALCT Sbjct: 61 EVVPKTVENFRALCT 75 >ref|XP_004231028.1| PREDICTED: choline transporter-like protein 3-like isoform 2 [Solanum lycopersicum] Length = 447 Score = 60.8 bits (146), Expect(2) = 5e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GE GK A+G +LHYKG PFHRIIPGFMI GGDIV Sbjct: 84 GEMGKTADGISLHYKGKPFHRIIPGFMIQGGDIV 117 Score = 25.0 bits (53), Expect(2) = 5e-09 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 16/35 (45%) Frame = +1 Query: 1 DIDKQR----------------VENFRALCTCTYG 57 DIDKQR VENFRALCT G Sbjct: 53 DIDKQRAGRIVIGLYGQVVPKTVENFRALCTGEMG 87 >ref|XP_006359677.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Solanum tuberosum] Length = 228 Score = 60.8 bits (146), Expect(2) = 5e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GE GK A+G +LHYKG PFHRIIPGFMI GGDIV Sbjct: 84 GEMGKTADGISLHYKGKPFHRIIPGFMIQGGDIV 117 Score = 25.0 bits (53), Expect(2) = 5e-09 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 16/35 (45%) Frame = +1 Query: 1 DIDKQR----------------VENFRALCTCTYG 57 DIDKQR VENFRALCT G Sbjct: 53 DIDKQRAGRIVIGLYGQVVPKTVENFRALCTGEMG 87 >gb|ESW09348.1| hypothetical protein PHAVU_009G120200g [Phaseolus vulgaris] Length = 232 Score = 62.4 bits (150), Expect(2) = 7e-09 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 GEKGK ANG LHYKGTPFHRII GFM GGDIV+ Sbjct: 94 GEKGKNANGVKLHYKGTPFHRIISGFMFQGGDIVH 128 Score = 23.1 bits (48), Expect(2) = 7e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 19 VENFRALCT 45 VENFRALCT Sbjct: 85 VENFRALCT 93 >ref|XP_006412168.1| hypothetical protein EUTSA_v10026179mg [Eutrema salsugineum] gi|557113338|gb|ESQ53621.1| hypothetical protein EUTSA_v10026179mg [Eutrema salsugineum] Length = 224 Score = 62.4 bits (150), Expect(2) = 7e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 GEKGK +NG+ LHYKGTPFHRII GF+I GGDI++ Sbjct: 85 GEKGKSSNGKPLHYKGTPFHRIISGFVIQGGDIIH 119 Score = 23.1 bits (48), Expect(2) = 7e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 19 VENFRALCT 45 VENFRALCT Sbjct: 76 VENFRALCT 84 >ref|XP_002305507.2| hypothetical protein POPTR_0004s17920g [Populus trichocarpa] gi|550341282|gb|EEE86018.2| hypothetical protein POPTR_0004s17920g [Populus trichocarpa] Length = 225 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +2 Query: 137 AQSFPFHKPGEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 A++F GEKGK A+G+ LHYKGTPFHRII GFMI GGDIVY Sbjct: 77 AENFRALCTGEKGKGASGKPLHYKGTPFHRIISGFMIQGGDIVY 120 >ref|XP_003537802.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like isoform X1 [Glycine max] Length = 236 Score = 60.5 bits (145), Expect(2) = 9e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 GEKGK NG LHYKGTPFHRII GF+I GGDIV+ Sbjct: 97 GEKGKSENGIKLHYKGTPFHRIISGFVIQGGDIVH 131 Score = 24.6 bits (52), Expect(2) = 9e-09 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 16/31 (51%) Frame = +1 Query: 1 DIDKQR----------------VENFRALCT 45 DIDKQR VENFRALCT Sbjct: 66 DIDKQRLGRIVIGLYGQVVPKTVENFRALCT 96 >ref|NP_001241966.1| uncharacterized protein LOC100808983 [Glycine max] gi|255641218|gb|ACU20886.1| unknown [Glycine max] Length = 236 Score = 60.5 bits (145), Expect(2) = 9e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 GEKGK NG LHYKGTPFHRII GF+I GGDIV+ Sbjct: 97 GEKGKSENGIKLHYKGTPFHRIISGFVIQGGDIVH 131 Score = 24.6 bits (52), Expect(2) = 9e-09 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 16/31 (51%) Frame = +1 Query: 1 DIDKQR----------------VENFRALCT 45 DIDKQR VENFRALCT Sbjct: 66 DIDKQRLGRIVIGLYGKVVPKTVENFRALCT 96 >gb|ACU19139.1| unknown [Glycine max] Length = 236 Score = 60.5 bits (145), Expect(2) = 9e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIVY 268 GEKGK NG LHYKGTPFHRII GF+I GGDIV+ Sbjct: 97 GEKGKSENGIKLHYKGTPFHRIISGFVIQGGDIVH 131 Score = 24.6 bits (52), Expect(2) = 9e-09 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 16/31 (51%) Frame = +1 Query: 1 DIDKQR----------------VENFRALCT 45 DIDKQR VENFRALCT Sbjct: 66 DIDKQRLGRIVIGLYGQVVPKTVENFRALCT 96 >tpg|DAA58192.1| TPA: hypothetical protein ZEAMMB73_458241 [Zea mays] Length = 528 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +2 Query: 122 FFLSEAQSFPFHKPGEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 F L A++F GEKG +NG+ LHYKG PFHRIIPGFMI GGDIV Sbjct: 436 FVLHSAENFRALCTGEKGVGSNGKPLHYKGIPFHRIIPGFMIQGGDIV 483 >ref|XP_003578523.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Brachypodium distachyon] Length = 216 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG G++LHYKGTPFHRIIPGFMI GGDIV Sbjct: 76 GEKGVGPKGKSLHYKGTPFHRIIPGFMIQGGDIV 109 Score = 23.5 bits (49), Expect(2) = 2e-08 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 1 DIDKQRVENFRALCT 45 ++ + VENFRALCT Sbjct: 61 EVVPKTVENFRALCT 75 >gb|AFW70308.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 330 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKG PFHRIIPGFMI GGDIV Sbjct: 163 GEKGVGSNGKPLHYKGIPFHRIIPGFMIQGGDIV 196 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 19 VENFRALCT 45 VENFRALCT Sbjct: 154 VENFRALCT 162 >gb|AFW70307.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 241 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 164 GEKGKIANGEALHYKGTPFHRIIPGFMIHGGDIV 265 GEKG +NG+ LHYKG PFHRIIPGFMI GGDIV Sbjct: 163 GEKGVGSNGKPLHYKGIPFHRIIPGFMIQGGDIV 196 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 19 VENFRALCT 45 VENFRALCT Sbjct: 154 VENFRALCT 162