BLASTX nr result
ID: Rauwolfia21_contig00037041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00037041 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155478.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_006357487.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_006357486.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004137020.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_004155478.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 259 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/69 (42%), Positives = 43/69 (62%) Frame = +1 Query: 151 FSTASSPPPDPESLKDTLYENLLRVPSSKDLIFRVLDRWVADGRHLGYLDIRNIIKRFRS 330 +ST S P P E DTL+ + R + I RVLD+WV +GR + D++ +IK+ R+ Sbjct: 24 YSTKSLPSPSTE---DTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRT 80 Query: 331 YKRFSHALQ 357 + RF+HALQ Sbjct: 81 FGRFNHALQ 89 >ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 486 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/69 (42%), Positives = 43/69 (62%) Frame = +1 Query: 151 FSTASSPPPDPESLKDTLYENLLRVPSSKDLIFRVLDRWVADGRHLGYLDIRNIIKRFRS 330 +ST S P P E DTL+ + R + I RVLD+WV +GR + D++ +IK+ R+ Sbjct: 24 YSTKSLPSPSTE---DTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRT 80 Query: 331 YKRFSHALQ 357 + RF+HALQ Sbjct: 81 FGRFNHALQ 89 >ref|XP_006357487.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Solanum tuberosum] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = +1 Query: 175 PDPESLKDTLYENLLRVPSSKDLIFRVLDRWVADGRHLGYLDIRNIIKRFRSYKRFSHAL 354 P S KD LY LL + SK+ + VLD+WV + + Y D+ I+K+FRSY+R++HAL Sbjct: 45 PLTSSPKDALYNRLLYLNRSKESVISVLDKWVTEQNPIMYEDLLIIVKQFRSYRRYNHAL 104 Query: 355 Q 357 Q Sbjct: 105 Q 105 >ref|XP_006357486.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum tuberosum] Length = 498 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/71 (38%), Positives = 44/71 (61%) Frame = +1 Query: 145 QCFSTASSPPPDPESLKDTLYENLLRVPSSKDLIFRVLDRWVADGRHLGYLDIRNIIKRF 324 QC + +S P K+ LY LL + SK+ + VLD+WV + + Y D+ I+++F Sbjct: 41 QCLNPLTSSP------KNALYSRLLYLTRSKESVISVLDKWVTEQNPIKYEDLLIIVRQF 94 Query: 325 RSYKRFSHALQ 357 R+Y+R++HALQ Sbjct: 95 RAYRRYNHALQ 105 >ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 493 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/69 (40%), Positives = 41/69 (59%) Frame = +1 Query: 151 FSTASSPPPDPESLKDTLYENLLRVPSSKDLIFRVLDRWVADGRHLGYLDIRNIIKRFRS 330 +ST S P P E DTL+ + R + I RVLD+WV +GR + D++ +IK+ R Sbjct: 24 YSTKSLPSPSTE---DTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRK 80 Query: 331 YKRFSHALQ 357 + RF+ ALQ Sbjct: 81 FGRFNQALQ 89 >ref|XP_004137020.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 146 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/69 (40%), Positives = 41/69 (59%) Frame = +1 Query: 151 FSTASSPPPDPESLKDTLYENLLRVPSSKDLIFRVLDRWVADGRHLGYLDIRNIIKRFRS 330 +ST S P P E DTL+ + R + I RVLD+WV +GR + D++ +IK+ R Sbjct: 24 YSTKSLPSPSTE---DTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRK 80 Query: 331 YKRFSHALQ 357 + RF+ ALQ Sbjct: 81 FGRFNQALQ 89