BLASTX nr result
ID: Rauwolfia21_contig00036988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00036988 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] 100 3e-19 emb|CBI20261.3| unnamed protein product [Vitis vinifera] 100 3e-19 ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat... 100 3e-19 ref|XP_006358965.1| PREDICTED: putative pentatricopeptide repeat... 92 9e-17 gb|EXC08475.1| hypothetical protein L484_009618 [Morus notabilis] 82 7e-14 ref|XP_004252116.1| PREDICTED: putative pentatricopeptide repeat... 82 7e-14 ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat... 79 6e-13 ref|XP_004488749.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 78 1e-12 ref|XP_003541836.1| PREDICTED: putative pentatricopeptide repeat... 75 1e-11 ref|XP_002532249.1| pentatricopeptide repeat-containing protein,... 75 1e-11 ref|XP_003595769.1| Pentatricopeptide repeat-containing protein ... 70 2e-10 ref|XP_006464901.1| PREDICTED: putative pentatricopeptide repeat... 70 3e-10 ref|XP_006451781.1| hypothetical protein CICLE_v10007960mg [Citr... 70 3e-10 gb|ESW21488.1| hypothetical protein PHAVU_005G075100g [Phaseolus... 68 1e-09 gb|EOY13086.1| Tetratricopeptide repeat (TPR)-like superfamily p... 67 2e-09 ref|XP_003623741.1| hypothetical protein MTR_7g075210 [Medicago ... 59 7e-07 ref|XP_002885074.1| pentatricopeptide repeat-containing protein ... 57 3e-06 ref|NP_188138.1| pentatricopeptide repeat-containing protein [Ar... 56 6e-06 ref|XP_006407002.1| hypothetical protein EUTSA_v10022416mg [Eutr... 55 1e-05 >emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] Length = 546 Score = 100 bits (248), Expect = 3e-19 Identities = 62/166 (37%), Positives = 85/166 (51%), Gaps = 12/166 (7%) Frame = +2 Query: 35 MHSRLQPLRRKLSRQIQLLFKYQCLAQPINDLLYNPFSRRINPFPFSVYAQYYNHLAR-H 211 MHSR Q L+ QL FK++ L QP R+ + P + Q+++ + Sbjct: 1 MHSRFQMLKLHSRVNTQLKFKFEFLTQP---------RRKHSILPHLIPNQHFHSTQNPN 51 Query: 212 IPGNLKAG-----------NPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTA 358 N + G +P R D + A+ +QNLLK + SV EIE L Sbjct: 52 SEFNFREGFERDEFVGLVADPGKREVFRRDPDGETALEVQNLLKTYRDSSVSEIEGALHQ 111 Query: 359 CNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSNGYFPGAGV 496 C L L++DLVLDVLKRHRSDW+PAY FF+W ++ +GY PG GV Sbjct: 112 CRLSLTDDLVLDVLKRHRSDWRPAYVFFNWASRCGXESGYSPGCGV 157 >emb|CBI20261.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 99.8 bits (247), Expect = 3e-19 Identities = 63/167 (37%), Positives = 84/167 (50%), Gaps = 13/167 (7%) Frame = +2 Query: 35 MHSRLQPLRRKLSRQIQLLFKYQCLAQPINDLLYNPFSRRINPFPFSVYAQYYNHLARHI 214 MHSR Q L+ QL FK++ L QP RR +P + + H ++ Sbjct: 1 MHSRFQMLKLYSRVNTQLKFKFEFLTQP----------RRKHPILPHIIPNQHFHSTQNP 50 Query: 215 PG--NLKAG-----------NPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLT 355 N + G +P R D + A+ +QNLLK + SV EIE L Sbjct: 51 NSEFNFREGFERDEFVGLVADPGKREVFRRDPDGETALEVQNLLKTYRDSSVSEIEGALH 110 Query: 356 ACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSNGYFPGAGV 496 C L L++DLVLDVLKRHRSDW+PAY FF+W ++ +GY PG GV Sbjct: 111 QCRLSLTDDLVLDVLKRHRSDWRPAYVFFNWASRCGIESGYSPGCGV 157 >ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Vitis vinifera] Length = 546 Score = 99.8 bits (247), Expect = 3e-19 Identities = 63/167 (37%), Positives = 84/167 (50%), Gaps = 13/167 (7%) Frame = +2 Query: 35 MHSRLQPLRRKLSRQIQLLFKYQCLAQPINDLLYNPFSRRINPFPFSVYAQYYNHLARHI 214 MHSR Q L+ QL FK++ L QP RR +P + + H ++ Sbjct: 1 MHSRFQMLKLYSRVNTQLKFKFEFLTQP----------RRKHPILPHIIPNQHFHSTQNP 50 Query: 215 PG--NLKAG-----------NPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLT 355 N + G +P R D + A+ +QNLLK + SV EIE L Sbjct: 51 NSEFNFREGFERDEFVGLVADPGKREVFRRDPDGETALEVQNLLKTYRDSSVSEIEGALH 110 Query: 356 ACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSNGYFPGAGV 496 C L L++DLVLDVLKRHRSDW+PAY FF+W ++ +GY PG GV Sbjct: 111 QCRLSLTDDLVLDVLKRHRSDWRPAYVFFNWASRCGIESGYSPGCGV 157 >ref|XP_006358965.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Solanum tuberosum] Length = 489 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/72 (58%), Positives = 56/72 (77%), Gaps = 1/72 (1%) Frame = +2 Query: 272 DDDN-AIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSW 448 D++N A+++Q LLK K +KSV +I Q L+ CN LSED +L+VLKRHRSDWKPA+TFF W Sbjct: 33 DEENCALKVQTLLKNKADKSVSDIFQSLSNCNFTLSEDFILNVLKRHRSDWKPAFTFFKW 92 Query: 449 VTKGKSSNGYFP 484 V G++ +GY P Sbjct: 93 VLAGENPSGYSP 104 >gb|EXC08475.1| hypothetical protein L484_009618 [Morus notabilis] Length = 530 Score = 82.0 bits (201), Expect = 7e-14 Identities = 37/73 (50%), Positives = 52/73 (71%) Frame = +2 Query: 272 DDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWV 451 +D A+ IQN++K + EKS +EIE+ L C L+E+L+L+VL RH+SDWK AY FF+W Sbjct: 87 NDRIAVWIQNIIKFRREKSTEEIERALDMCGFELTEELLLNVLHRHQSDWKLAYVFFNWA 146 Query: 452 TKGKSSNGYFPGA 490 KG SNG+ G+ Sbjct: 147 CKGGGSNGFLLGS 159 >ref|XP_004252116.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Solanum lycopersicum] Length = 488 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/72 (52%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Frame = +2 Query: 272 DDDN-AIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSW 448 D++N A+ +Q LK K +KSV +I Q L+ CN LSED +L+VLKRHRSDWKPA+ FF W Sbjct: 32 DEENCALEVQTFLKNKADKSVSDIFQSLSDCNFTLSEDFILNVLKRHRSDWKPAFIFFKW 91 Query: 449 VTKGKSSNGYFP 484 + G++ Y P Sbjct: 92 ILAGENPCRYSP 103 >ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Cucumis sativus] gi|449502917|ref|XP_004161779.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Cucumis sativus] Length = 532 Score = 79.0 bits (193), Expect = 6e-13 Identities = 45/120 (37%), Positives = 67/120 (55%), Gaps = 12/120 (10%) Frame = +2 Query: 167 PFSVYAQYYNHLARHIPGNLKAGNPDFRTDASPSV-----------DDDNAIRIQNLLKL 313 PFSV + +H+ N RT S S+ DD +A+ +QN+L Sbjct: 42 PFSVVSDPIHHILSCHNLTPSPRNCHDRTLVSDSIAVSDEPITVHPDDPSAVYVQNVLYF 101 Query: 314 KPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTK-GKSSNGYFPGA 490 + K V++IE+ L+ C+L L++D VL VL+RHRSDW PA+ FF+WV K G + + PG+ Sbjct: 102 RRHKPVEDIERALSLCDLVLTDDFVLKVLRRHRSDWNPAFIFFNWVLKRGTNEEKFTPGS 161 >ref|XP_004488749.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g15200-like [Cicer arietinum] Length = 503 Score = 78.2 bits (191), Expect = 1e-12 Identities = 42/103 (40%), Positives = 58/103 (56%) Frame = +2 Query: 188 YYNHLARHIPGNLKAGNPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNL 367 +Y +L + P +P F + A IQNLLK + +K Q+IE L C + Sbjct: 43 HYRNLIQQSPNTT---SPKFDRFLHSHPESPPASFIQNLLKFRRDKPTQQIEHALNLCKI 99 Query: 368 WLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSNGYFPGAGV 496 + +LVL+VL+RHRSDWKPA+TFF WV+K +N Y P V Sbjct: 100 HPNHELVLEVLQRHRSDWKPAFTFFKWVSK---TNNYTPSCHV 139 >ref|XP_003541836.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Glycine max] Length = 481 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/92 (42%), Positives = 55/92 (59%) Frame = +2 Query: 221 NLKAGNPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVL 400 N+K P F V A IQNLLK + +K +++ + L C L+ DLVLDVL Sbjct: 22 NVKTSTPRF-------VHSCPATFIQNLLKFRRDKPTEQLYRALDQCGFDLNHDLVLDVL 74 Query: 401 KRHRSDWKPAYTFFSWVTKGKSSNGYFPGAGV 496 +RHRSDW+PA+ FF+W + K++ GY P + V Sbjct: 75 RRHRSDWRPAHVFFNWAS--KTTTGYQPSSDV 104 >ref|XP_002532249.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528067|gb|EEF30143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = +2 Query: 284 AIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKG 460 A+++QN+LK + ++IE LT CN ++EDL+L VLKRHRSDWKPA FF+WV+KG Sbjct: 49 ALKVQNVLKNYRDSPTRKIELALTQCNPTVTEDLILKVLKRHRSDWKPALIFFNWVSKG 107 >ref|XP_003595769.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355484817|gb|AES66020.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 497 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/68 (50%), Positives = 45/68 (66%) Frame = +2 Query: 293 IQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSN 472 IQNLLK + +K ++IEQ L + + +LVL VL+RHRSDWKPA+ FF WV+K +N Sbjct: 69 IQNLLKFRRDKPTEQIEQALNLIGIHPNNNLVLQVLQRHRSDWKPAFIFFKWVSK---TN 125 Query: 473 GYFPGAGV 496 Y P V Sbjct: 126 NYTPSCEV 133 >ref|XP_006464901.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Citrus sinensis] Length = 536 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/87 (39%), Positives = 53/87 (60%) Frame = +2 Query: 236 NPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRS 415 N D +++ D+ AI +QN+LK + EIE+ L C L L++DL+++V+ R+R Sbjct: 75 NSDEKSEFQRYPGDEIAINVQNILKTCSVSTKGEIEKALNQCELTLTDDLIVNVINRYRF 134 Query: 416 DWKPAYTFFSWVTKGKSSNGYFPGAGV 496 DW+ AYTFF WV++ Y PG+ V Sbjct: 135 DWEAAYTFFKWVSR---EGDYSPGSNV 158 >ref|XP_006451781.1| hypothetical protein CICLE_v10007960mg [Citrus clementina] gi|557555007|gb|ESR65021.1| hypothetical protein CICLE_v10007960mg [Citrus clementina] Length = 536 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/87 (39%), Positives = 53/87 (60%) Frame = +2 Query: 236 NPDFRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRS 415 N D +++ D+ AI +QN+LK + EIE+ L C L L++DL+++V+ R+R Sbjct: 75 NSDEKSEFQRYPGDEIAINVQNILKTCSVSTKGEIEKALNQCELTLTDDLIVNVINRYRF 134 Query: 416 DWKPAYTFFSWVTKGKSSNGYFPGAGV 496 DW+ AYTFF WV++ Y PG+ V Sbjct: 135 DWEAAYTFFKWVSR---EGDYSPGSNV 158 >gb|ESW21488.1| hypothetical protein PHAVU_005G075100g [Phaseolus vulgaris] Length = 478 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = +2 Query: 293 IQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSN 472 IQNLLK + +K ++ + L C + L+ +LVLDVL+RHRSDW+PA+ FF+W + Sbjct: 38 IQNLLKFRRDKPTDQLHRALDQCGVDLNHNLVLDVLRRHRSDWRPAHVFFNW----SKTA 93 Query: 473 GYFPGAGV 496 GY P + V Sbjct: 94 GYEPSSDV 101 >gb|EOY13086.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 534 Score = 67.0 bits (162), Expect = 2e-09 Identities = 45/140 (32%), Positives = 72/140 (51%), Gaps = 10/140 (7%) Frame = +2 Query: 89 LFKYQCLAQPINDLLYNPFSRRINPFPFS-VYAQYYNHLARHIPGNLKAGNPDFRTDASP 265 +FK + L ++ F I+ F F+ + + H G +K P FR+ AS Sbjct: 4 IFKCRSLNSLSRGTIHRKFKFPISYFHFTPIPRNQATNPTFHFLGTIKK-LPFFRSFASS 62 Query: 266 SV--------DDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDW 421 D + +QN+L S++EIEQ L C + ++E L LD+++R+RSDW Sbjct: 63 GESIDFQQFPDGKYVLELQNILNNHRNSSIEEIEQALDQCEVTMTEGLALDLVRRNRSDW 122 Query: 422 KPAYTFFSWVT-KGKSSNGY 478 K A+ FF WV+ KG++S G+ Sbjct: 123 KLAHVFFQWVSKKGENSLGF 142 >ref|XP_003623741.1| hypothetical protein MTR_7g075210 [Medicago truncatula] gi|355498756|gb|AES79959.1| hypothetical protein MTR_7g075210 [Medicago truncatula] Length = 292 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = +2 Query: 320 EKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAYTFFSWVTKGKSSNGYFPGAGV 496 +K ++IE+ L + +LVL++L+RHRSDWKPA+ FF WVTK +N Y P V Sbjct: 113 DKPTEQIERALNLTGIHPDSNLVLELLQRHRSDWKPAFIFFKWVTK---TNNYTPSCEV 168 >ref|XP_002885074.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330914|gb|EFH61333.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/68 (38%), Positives = 42/68 (61%) Frame = +2 Query: 254 DASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPAY 433 D P+ + +A+ + N++K S +EIE+ L C + L+E+LV +V+ R+RSDWKPAY Sbjct: 62 DKFPNGFNQSAVDVHNIIKHHRGSSPEEIERILDKCGIQLTEELVFEVVNRNRSDWKPAY 121 Query: 434 TFFSWVTK 457 + K Sbjct: 122 ILSRLIVK 129 >ref|NP_188138.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273407|sp|Q9LIL5.1|PP233_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g15200 gi|11994509|dbj|BAB02574.1| unnamed protein product [Arabidopsis thaliana] gi|332642110|gb|AEE75631.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 523 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 1/90 (1%) Frame = +2 Query: 191 YNHLARHIPGNLKAGNPD-FRTDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNL 367 ++ L H +L G PD F + D +A+ + N++K S ++I++ L C + Sbjct: 48 FHFLGTHFLHSL--GAPDKFPNRFNDDKDKQSALDVHNIIKHHRGSSPEKIKRILDKCGI 105 Query: 368 WLSEDLVLDVLKRHRSDWKPAYTFFSWVTK 457 L+E+LVL+V+ R+RSDWKPAY V K Sbjct: 106 DLTEELVLEVVNRNRSDWKPAYILSQLVVK 135 >ref|XP_006407002.1| hypothetical protein EUTSA_v10022416mg [Eutrema salsugineum] gi|557108148|gb|ESQ48455.1| hypothetical protein EUTSA_v10022416mg [Eutrema salsugineum] Length = 525 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/69 (37%), Positives = 41/69 (59%) Frame = +2 Query: 251 TDASPSVDDDNAIRIQNLLKLKPEKSVQEIEQCLTACNLWLSEDLVLDVLKRHRSDWKPA 430 T + + D ++ + N++K S +EIE+ L C + L+E L L+V+ R+RSDWKPA Sbjct: 69 TGFNENQDTQSSFDVHNIIKNHRGSSSEEIERILDKCRIRLTEGLALEVVNRNRSDWKPA 128 Query: 431 YTFFSWVTK 457 YT + K Sbjct: 129 YTLSQLIRK 137