BLASTX nr result
ID: Rauwolfia21_contig00036937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00036937 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002865742.1| hypothetical protein ARALYDRAFT_495017 [Arab... 58 1e-06 ref|XP_002512221.1| peptide n-glycanase, putative [Ricinus commu... 57 3e-06 ref|XP_006432973.1| hypothetical protein CICLE_v10000348mg [Citr... 57 3e-06 ref|XP_006432972.1| hypothetical protein CICLE_v10000348mg [Citr... 57 3e-06 ref|NP_001234560.1| putative peptide:N-glycanase [Solanum lycope... 56 4e-06 ref|XP_002319053.2| hypothetical protein POPTR_0013s03720g [Popu... 55 8e-06 ref|XP_006282171.1| hypothetical protein CARUB_v10028450mg [Caps... 55 8e-06 ref|XP_002278422.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco... 55 8e-06 ref|XP_006347760.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-gluco... 55 1e-05 >ref|XP_002865742.1| hypothetical protein ARALYDRAFT_495017 [Arabidopsis lyrata subsp. lyrata] gi|297311577|gb|EFH42001.1| hypothetical protein ARALYDRAFT_495017 [Arabidopsis lyrata subsp. lyrata] Length = 721 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVARKFVV+H++S FDVDYDT+DG EVL+FQ+F Sbjct: 1 MVARKFVVHHEDSSFDVDYDTEDGLEVLRFQIF 33 >ref|XP_002512221.1| peptide n-glycanase, putative [Ricinus communis] gi|223548182|gb|EEF49673.1| peptide n-glycanase, putative [Ricinus communis] Length = 719 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVARKF+V + NS FD+DYDTDDGFEV +FQLF Sbjct: 1 MVARKFLVRYSNSTFDLDYDTDDGFEVFKFQLF 33 >ref|XP_006432973.1| hypothetical protein CICLE_v10000348mg [Citrus clementina] gi|557535095|gb|ESR46213.1| hypothetical protein CICLE_v10000348mg [Citrus clementina] Length = 780 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +3 Query: 96 FQEAKNRFKNMVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 +Q+ NR M ARKF V H++S FDVDYDT DG EV +FQLF Sbjct: 47 WQKTSNRENKMAARKFSVRHRDSTFDVDYDTADGLEVFRFQLF 89 >ref|XP_006432972.1| hypothetical protein CICLE_v10000348mg [Citrus clementina] gi|557535094|gb|ESR46212.1| hypothetical protein CICLE_v10000348mg [Citrus clementina] Length = 687 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +3 Query: 96 FQEAKNRFKNMVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 +Q+ NR M ARKF V H++S FDVDYDT DG EV +FQLF Sbjct: 47 WQKTSNRENKMAARKFSVRHRDSTFDVDYDTADGLEVFRFQLF 89 >ref|NP_001234560.1| putative peptide:N-glycanase [Solanum lycopersicum] gi|303306032|gb|ADM13644.1| putative peptide:N-glycanase [Solanum lycopersicum] Length = 725 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVAR+ V H +S+FDVDYDTDDGFEVL++QLF Sbjct: 1 MVARRLAVSHNDSIFDVDYDTDDGFEVLKYQLF 33 >ref|XP_002319053.2| hypothetical protein POPTR_0013s03720g [Populus trichocarpa] gi|550324883|gb|EEE94976.2| hypothetical protein POPTR_0013s03720g [Populus trichocarpa] Length = 757 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVAR+F++ H +S+FDVDYDTDDG EVL+ QLF Sbjct: 1 MVARQFIISHNDSIFDVDYDTDDGLEVLKIQLF 33 >ref|XP_006282171.1| hypothetical protein CARUB_v10028450mg [Capsella rubella] gi|482550875|gb|EOA15069.1| hypothetical protein CARUB_v10028450mg [Capsella rubella] Length = 722 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVAR+FVV H++S FDVDYDT+DG EVL+FQ+F Sbjct: 1 MVARRFVVRHEDSSFDVDYDTEDGLEVLRFQIF 33 >ref|XP_002278422.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Vitis vinifera] gi|298204879|emb|CBI34186.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVARKF+V H +S F VDYDTDDGFEV +FQLF Sbjct: 1 MVARKFIVSHNDSDFHVDYDTDDGFEVFKFQLF 33 >ref|XP_006347760.1| PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase-like isoform X2 [Solanum tuberosum] Length = 725 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 126 MVARKFVVYHQNSVFDVDYDTDDGFEVLQFQLF 224 MVAR+ V H +S FDVDYDTDDGFEVL++QLF Sbjct: 1 MVARRLAVSHNDSTFDVDYDTDDGFEVLKYQLF 33