BLASTX nr result
ID: Rauwolfia21_contig00036804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00036804 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005558326.1| PREDICTED: 40S ribosomal protein S14 isoform... 59 9e-07 gb|AFW87287.1| hypothetical protein ZEAMMB73_611145 [Zea mays] 58 1e-06 ref|XP_004966228.1| PREDICTED: 40S ribosomal protein S14-like is... 57 2e-06 ref|XP_004966226.1| PREDICTED: 40S ribosomal protein S14-like is... 57 2e-06 ref|XP_004966224.1| PREDICTED: 40S ribosomal protein S14-like is... 57 2e-06 ref|XP_004737879.1| PREDICTED: 40S ribosomal protein S14 isoform... 57 3e-06 ref|XP_002299781.2| hypothetical protein POPTR_0001s22620g [Popu... 56 4e-06 ref|XP_006295173.1| hypothetical protein CARUB_v10024253mg [Caps... 56 4e-06 gb|AFW75985.1| hypothetical protein ZEAMMB73_882157 [Zea mays] 56 4e-06 gb|AFW62679.1| hypothetical protein ZEAMMB73_559285, partial [Ze... 56 4e-06 ref|XP_005209606.1| PREDICTED: 40S ribosomal protein S14 isoform... 56 6e-06 ref|XP_005209601.1| PREDICTED: 40S ribosomal protein S14 isoform... 56 6e-06 ref|NP_001071298.1| 40S ribosomal protein S14 [Bos taurus] gi|74... 56 6e-06 ref|XP_006714853.1| PREDICTED: 40S ribosomal protein S14 isoform... 55 1e-05 ref|XP_005010587.1| PREDICTED: 40S ribosomal protein S14 [Anas p... 55 1e-05 ref|XP_004854479.1| PREDICTED: 40S ribosomal protein S14-like is... 55 1e-05 ref|XP_004737877.1| PREDICTED: 40S ribosomal protein S14 isoform... 55 1e-05 ref|XP_004486034.1| PREDICTED: 40S ribosomal protein S14-like is... 55 1e-05 gb|EOA92699.1| 40S ribosomal protein S14, partial [Anas platyrhy... 55 1e-05 gb|AEM37695.1| ribosomal protein S14 [Epinephelus bruneus] 55 1e-05 >ref|XP_005558326.1| PREDICTED: 40S ribosomal protein S14 isoform X1 [Macaca fascicularis] gi|544440379|ref|XP_005558327.1| PREDICTED: 40S ribosomal protein S14 isoform X2 [Macaca fascicularis] Length = 179 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSLF*CCVANAHSSSLVGRLMK 162 +TKTPGPGAQSALRALARSGMKIGRIG + + C A+A S+ + M+ Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIGRCPPLANAWICFEASAPKSTCCAQWMR 157 >gb|AFW87287.1| hypothetical protein ZEAMMB73_611145 [Zea mays] Length = 132 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKT 90 KTKTPGPGAQSALRALARSGMKIGRIG K+ Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIGKKS 132 >ref|XP_004966228.1| PREDICTED: 40S ribosomal protein S14-like isoform X5 [Setaria italica] Length = 157 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSL 105 KTKTPGPGAQSALRALARSGMKIGRIG YF L Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIG---KYFDL 134 >ref|XP_004966226.1| PREDICTED: 40S ribosomal protein S14-like isoform X3 [Setaria italica] Length = 166 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSL 105 KTKTPGPGAQSALRALARSGMKIGRIG YF L Sbjct: 112 KTKTPGPGAQSALRALARSGMKIGRIG---KYFDL 143 >ref|XP_004966224.1| PREDICTED: 40S ribosomal protein S14-like isoform X1 [Setaria italica] Length = 173 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSL 105 KTKTPGPGAQSALRALARSGMKIGRIG YF L Sbjct: 119 KTKTPGPGAQSALRALARSGMKIGRIG---KYFDL 150 >ref|XP_004737879.1| PREDICTED: 40S ribosomal protein S14 isoform X3 [Mustela putorius furo] Length = 136 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTS 93 +TKTPGPGAQSALRALARSGMKIGRIG S Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIGNSNS 134 >ref|XP_002299781.2| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] gi|550347908|gb|EEE84586.2| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] Length = 133 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 KTKTPGPGAQSALRALARSGMKIGRIG Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIG 129 >ref|XP_006295173.1| hypothetical protein CARUB_v10024253mg [Capsella rubella] gi|482563881|gb|EOA28071.1| hypothetical protein CARUB_v10024253mg [Capsella rubella] Length = 147 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 KTKTPGPGAQSALRALARSGMKIGRIG Sbjct: 104 KTKTPGPGAQSALRALARSGMKIGRIG 130 >gb|AFW75985.1| hypothetical protein ZEAMMB73_882157 [Zea mays] Length = 194 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 KTKTPGPGAQSALRALARSGMKIGRIG Sbjct: 103 KTKTPGPGAQSALRALARSGMKIGRIG 129 >gb|AFW62679.1| hypothetical protein ZEAMMB73_559285, partial [Zea mays] Length = 74 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 KTKTPGPGAQSALRALARSGMKIGRIG Sbjct: 45 KTKTPGPGAQSALRALARSGMKIGRIG 71 >ref|XP_005209606.1| PREDICTED: 40S ribosomal protein S14 isoform X6 [Bos taurus] Length = 172 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSLF*C 114 +TKTPGPGAQSALRALARSGMKIGRIG S + C Sbjct: 111 RTKTPGPGAQSALRALARSGMKIGRIGEYPSLADAWFC 148 >ref|XP_005209601.1| PREDICTED: 40S ribosomal protein S14 isoform X1 [Bos taurus] gi|528957161|ref|XP_005209602.1| PREDICTED: 40S ribosomal protein S14 isoform X2 [Bos taurus] Length = 165 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSLF*C 114 +TKTPGPGAQSALRALARSGMKIGRIG S + C Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIGEYPSLADAWFC 141 >ref|NP_001071298.1| 40S ribosomal protein S14 [Bos taurus] gi|74268249|gb|AAI02537.1| Ribosomal protein S14 [Bos taurus] gi|296485154|tpg|DAA27269.1| TPA: ribosomal protein S14 [Bos taurus] Length = 157 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIGTKTSYFSL 105 +TKTPGPGAQSALRALARSGMKIGRIG + +L Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIGNTKCHSAL 138 >ref|XP_006714853.1| PREDICTED: 40S ribosomal protein S14 isoform X1 [Homo sapiens] Length = 178 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 +TKTPGPGAQSALRALARSGMKIGRIG Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIG 130 >ref|XP_005010587.1| PREDICTED: 40S ribosomal protein S14 [Anas platyrhynchos] Length = 131 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 +TKTPGPGAQSALRALARSGMKIGRIG Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIG 130 >ref|XP_004854479.1| PREDICTED: 40S ribosomal protein S14-like isoform X1 [Heterocephalus glaber] Length = 169 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 +TKTPGPGAQSALRALARSGMKIGRIG Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIG 130 >ref|XP_004737877.1| PREDICTED: 40S ribosomal protein S14 isoform X1 [Mustela putorius furo] Length = 154 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 +TKTPGPGAQSALRALARSGMKIGRIG Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIG 130 >ref|XP_004486034.1| PREDICTED: 40S ribosomal protein S14-like isoform X1 [Cicer arietinum] Length = 158 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 KTKTPGPGAQ+ALRALARSGMKIGRIG Sbjct: 104 KTKTPGPGAQAALRALARSGMKIGRIG 130 >gb|EOA92699.1| 40S ribosomal protein S14, partial [Anas platyrhynchos] Length = 82 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 +TKTPGPGAQSALRALARSGMKIGRIG Sbjct: 55 RTKTPGPGAQSALRALARSGMKIGRIG 81 >gb|AEM37695.1| ribosomal protein S14 [Epinephelus bruneus] Length = 138 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 KTKTPGPGAQSALRALARSGMKIGRIG 81 +TKTPGPGAQSALRALARSGMKIGRIG Sbjct: 104 RTKTPGPGAQSALRALARSGMKIGRIG 130