BLASTX nr result
ID: Rauwolfia21_contig00036502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00036502 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291067.1| PREDICTED: probable isoaspartyl peptidase/L-... 59 9e-07 >ref|XP_004291067.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like [Fragaria vesca subsp. vesca] Length = 327 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 248 GVEMVDNNNYFITEDNVGMLKLAKEANTIL 337 GVE+VDNN+YFITE+NVGMLKLAKEANTIL Sbjct: 133 GVELVDNNDYFITEENVGMLKLAKEANTIL 162