BLASTX nr result
ID: Rauwolfia21_contig00035905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00035905 (437 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360615.1| PREDICTED: psbP-like protein 2, chloroplasti... 56 4e-06 ref|XP_004248685.1| PREDICTED: psbP-like protein 2, chloroplasti... 55 1e-05 >ref|XP_006360615.1| PREDICTED: psbP-like protein 2, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 226 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 133 MGSVKQS*QFLTSVCTFSTGVPDKYEVFVDKADGYSYYYPSDWR 2 +G+ S L + + GVP+ YE+FVDK DGYSYYYPSDWR Sbjct: 52 LGAGALSLNLLPATPLLAQGVPENYEIFVDKRDGYSYYYPSDWR 95 >ref|XP_004248685.1| PREDICTED: psbP-like protein 2, chloroplastic-like [Solanum lycopersicum] Length = 227 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -2 Query: 76 GVPDKYEVFVDKADGYSYYYPSDWR 2 GVP+ YE+FVDK DGYSYYYPSDWR Sbjct: 72 GVPENYEIFVDKRDGYSYYYPSDWR 96