BLASTX nr result
ID: Rauwolfia21_contig00034472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00034472 (385 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522368.1| DNA binding protein, putative [Ricinus commu... 58 1e-06 emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera] 57 2e-06 ref|XP_006425800.1| hypothetical protein CICLE_v10026137mg [Citr... 55 7e-06 >ref|XP_002522368.1| DNA binding protein, putative [Ricinus communis] gi|223538446|gb|EEF40052.1| DNA binding protein, putative [Ricinus communis] Length = 280 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 5/95 (5%) Frame = +2 Query: 11 KYTVTIPREVTSLLKLRKKTEMVLRDEGGTEWPVKLYKCADSRVMFGSGWMQFRNGNDLR 190 +YTV + R V L+ + M LR E G WPVK+ D R++ +GW F + + Sbjct: 182 RYTVYVHRLVVKTHNLKLQENMKLRGESGKFWPVKVCFRTDGRIIINNGWAAFHRKHKVA 241 Query: 191 DSDSCKFTFL--EGGSSKVIQVKVLR---GHGRRE 280 D+C F F+ E K IQV++LR H ++E Sbjct: 242 IGDTCVFEFIPAENNMVKEIQVQILRKPVNHTKKE 276 >emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera] Length = 765 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%) Frame = +2 Query: 11 KYTVTIPREVTSLLKLRKKTEMVLRDEGGTEWPVKLYKCADSRVMFGSGWMQFRNGNDLR 190 +Y + IP+ V ++ + EMV+RD+ WP++L D R+ GW +F N+L Sbjct: 669 RYNLYIPQHVLKXNNIKLEGEMVMRDQKDRSWPMRLTTRKDGRLALVKGWAKFWKENNLG 728 Query: 191 DSDSCKFTFL--EGGSSKVIQVKVLR 262 D C F F+ G SK I V+V+R Sbjct: 729 RRDQCVFEFILGRGRISKEIHVQVIR 754 >ref|XP_006425800.1| hypothetical protein CICLE_v10026137mg [Citrus clementina] gi|568824576|ref|XP_006466673.1| PREDICTED: putative B3 domain-containing protein At5g66980-like [Citrus sinensis] gi|557527790|gb|ESR39040.1| hypothetical protein CICLE_v10026137mg [Citrus clementina] Length = 309 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +2 Query: 11 KYTVTIPREVTSLLKLRKKTEMVLRDEGGTEWPVKLYKCADSRVMFGSGWMQFRNGNDLR 190 +Y V + V ++ + EM+LRD+ G +WPVK+ + R++ GW F L Sbjct: 218 RYAVNVSVRVVRSHGIKLEPEMMLRDQNGRKWPVKISFRTNGRIVITGGWSDFWREQKLE 277 Query: 191 DSDSCKFTFL--EGGSSKVIQVKVLR 262 D C F F+ G SK ++V+V+R Sbjct: 278 AGDKCVFEFVLTRGNMSKEMKVQVVR 303