BLASTX nr result
ID: Rauwolfia21_contig00031679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00031679 (526 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350983.1| PREDICTED: nuclear distribution protein PAC1... 55 7e-06 >ref|XP_006350983.1| PREDICTED: nuclear distribution protein PAC1-1-like [Solanum tuberosum] Length = 657 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +3 Query: 3 NHLEELQHQNNSPNCRNYSATWGLVIVTAGWDGMIRTFHNW 125 +HL + N + N R S WGLVIVTAGWDG IRTFHN+ Sbjct: 611 DHLHQQHQHNKNLNYRALSPAWGLVIVTAGWDGKIRTFHNY 651