BLASTX nr result
ID: Rauwolfia21_contig00030852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00030852 (493 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] 57 3e-06 ref|XP_002324414.1| hypothetical protein POPTR_0018s05880g [Popu... 56 6e-06 >gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] Length = 84 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +1 Query: 325 CLCSPTKHLGSFRCRQHRAKYVWGGR 402 CLCSPTKH GSFRCR H A+YVWGGR Sbjct: 54 CLCSPTKHPGSFRCRHHHAEYVWGGR 79 >ref|XP_002324414.1| hypothetical protein POPTR_0018s05880g [Populus trichocarpa] gi|222865848|gb|EEF02979.1| hypothetical protein POPTR_0018s05880g [Populus trichocarpa] Length = 85 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +1 Query: 325 CLCSPTKHLGSFRCRQHRAKYVWGG---RRKQ 411 CLCSPT+H GSFRCR HR+ YVWGG RRKQ Sbjct: 52 CLCSPTRHPGSFRCRHHRSDYVWGGRITRRKQ 83