BLASTX nr result
ID: Rauwolfia21_contig00030818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00030818 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277711.2| PREDICTED: anaphase-promoting complex subuni... 55 1e-05 emb|CBI38557.3| unnamed protein product [Vitis vinifera] 55 1e-05 emb|CAN72563.1| hypothetical protein VITISV_011377 [Vitis vinifera] 55 1e-05 >ref|XP_002277711.2| PREDICTED: anaphase-promoting complex subunit cdc20-like [Vitis vinifera] Length = 454 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 246 QKESCILDAPNLKDDYYLNVMDWGSSNLLAVAL 344 +KES +LDAP + DDYYLN+MDWG N+LA+AL Sbjct: 123 KKESRVLDAPRINDDYYLNIMDWGKRNILAIAL 155 >emb|CBI38557.3| unnamed protein product [Vitis vinifera] Length = 469 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 246 QKESCILDAPNLKDDYYLNVMDWGSSNLLAVAL 344 +KES +LDAP + DDYYLN+MDWG N+LA+AL Sbjct: 124 KKESRVLDAPRINDDYYLNIMDWGKRNILAIAL 156 >emb|CAN72563.1| hypothetical protein VITISV_011377 [Vitis vinifera] Length = 455 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 246 QKESCILDAPNLKDDYYLNVMDWGSSNLLAVAL 344 +KES +LDAP + DDYYLN+MDWG N+LA+AL Sbjct: 123 KKESRVLDAPRINDDYYLNIMDWGKRNILAIAL 155