BLASTX nr result
ID: Rauwolfia21_contig00030611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00030611 (211 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349363.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 74 2e-11 ref|XP_006349362.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 74 2e-11 ref|XP_006349361.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 74 2e-11 ref|XP_004230479.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 74 2e-11 gb|EOX98193.1| RING/U-box superfamily protein, putative [Theobro... 67 2e-09 ref|NP_567943.1| RING/U-box domain-containing protein [Arabidops... 67 2e-09 dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] 67 2e-09 ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arab... 67 2e-09 emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|72703... 67 2e-09 gb|AAM62531.1| unknown [Arabidopsis thaliana] 67 2e-09 ref|XP_002521847.1| Armadillo repeat-containing protein, putativ... 65 9e-09 ref|XP_006384443.1| hypothetical protein POPTR_0004s15130g [Popu... 64 2e-08 ref|XP_006384442.1| hypothetical protein POPTR_0004s15130g [Popu... 64 2e-08 ref|XP_002330318.1| predicted protein [Populus trichocarpa] 64 2e-08 ref|XP_006412296.1| hypothetical protein EUTSA_v10026077mg [Eutr... 63 5e-08 ref|XP_006412295.1| hypothetical protein EUTSA_v10026077mg [Eutr... 63 5e-08 ref|XP_006480137.1| PREDICTED: armadillo repeat-containing prote... 62 8e-08 ref|XP_006423067.1| hypothetical protein CICLE_v10029827mg, part... 62 8e-08 ref|XP_004230478.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 57 3e-06 ref|XP_004230477.1| PREDICTED: E3 ubiquitin-protein ligase RNF17... 57 3e-06 >ref|XP_006349363.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform X3 [Solanum tuberosum] Length = 268 Score = 74.3 bits (181), Expect = 2e-11 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNYG 211 ICFG F VPCR PCGHWYCGGCILQYWNYG Sbjct: 130 ICFGNFVVPCRGPCGHWYCGGCILQYWNYG 159 >ref|XP_006349362.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform X2 [Solanum tuberosum] Length = 310 Score = 74.3 bits (181), Expect = 2e-11 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNYG 211 ICFG F VPCR PCGHWYCGGCILQYWNYG Sbjct: 130 ICFGNFVVPCRGPCGHWYCGGCILQYWNYG 159 >ref|XP_006349361.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform X1 [Solanum tuberosum] Length = 316 Score = 74.3 bits (181), Expect = 2e-11 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNYG 211 ICFG F VPCR PCGHWYCGGCILQYWNYG Sbjct: 130 ICFGNFVVPCRGPCGHWYCGGCILQYWNYG 159 >ref|XP_004230479.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Solanum lycopersicum] Length = 312 Score = 74.3 bits (181), Expect = 2e-11 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNYG 211 ICFG F VPCR PCGHWYCGGCILQYWNYG Sbjct: 132 ICFGNFVVPCRGPCGHWYCGGCILQYWNYG 161 >gb|EOX98193.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 231 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = +2 Query: 74 EEKRXXXXXXXXXXXXICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 E KR ICFG+F VPCR+ CGHWYCG CILQ+WNY Sbjct: 15 ERKRLSETPPDDDCCPICFGSFTVPCRSNCGHWYCGSCILQFWNY 59 >ref|NP_567943.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|63003762|gb|AAY25410.1| At4g33940 [Arabidopsis thaliana] gi|87116618|gb|ABD19673.1| At4g33940 [Arabidopsis thaliana] gi|332660897|gb|AEE86297.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 262 Score = 67.0 bits (162), Expect = 2e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG+F VPCR CGHWYCG CILQYWNY Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNY 104 >dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] Length = 252 Score = 67.0 bits (162), Expect = 2e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG+F VPCR CGHWYCG CILQYWNY Sbjct: 66 ICFGSFTVPCRGNCGHWYCGNCILQYWNY 94 >ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] gi|297315020|gb|EFH45443.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] Length = 683 Score = 67.0 bits (162), Expect = 2e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG+F VPCR CGHWYCG CILQYWNY Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNY 104 >emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|7270343|emb|CAB80111.1| putative protein [Arabidopsis thaliana] Length = 670 Score = 67.0 bits (162), Expect = 2e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG+F VPCR CGHWYCG CILQYWNY Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNY 104 >gb|AAM62531.1| unknown [Arabidopsis thaliana] Length = 262 Score = 67.0 bits (162), Expect = 2e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG+F VPCR CGHWYCG CILQYWNY Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNY 104 >ref|XP_002521847.1| Armadillo repeat-containing protein, putative [Ricinus communis] gi|223538885|gb|EEF40483.1| Armadillo repeat-containing protein, putative [Ricinus communis] Length = 719 Score = 65.1 bits (157), Expect = 9e-09 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG F +PC++ CGHWYCG CILQYWNY Sbjct: 69 ICFGTFTIPCKSICGHWYCGSCILQYWNY 97 >ref|XP_006384443.1| hypothetical protein POPTR_0004s15130g [Populus trichocarpa] gi|550341061|gb|ERP62240.1| hypothetical protein POPTR_0004s15130g [Populus trichocarpa] Length = 182 Score = 64.3 bits (155), Expect = 2e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG F VPC+A CGHWYCG CILQYW Y Sbjct: 58 ICFGTFDVPCKANCGHWYCGSCILQYWKY 86 >ref|XP_006384442.1| hypothetical protein POPTR_0004s15130g [Populus trichocarpa] gi|550341060|gb|ERP62239.1| hypothetical protein POPTR_0004s15130g [Populus trichocarpa] Length = 239 Score = 64.3 bits (155), Expect = 2e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG F VPC+A CGHWYCG CILQYW Y Sbjct: 58 ICFGTFDVPCKANCGHWYCGSCILQYWKY 86 >ref|XP_002330318.1| predicted protein [Populus trichocarpa] Length = 195 Score = 64.3 bits (155), Expect = 2e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG F VPC+A CGHWYCG CILQYW Y Sbjct: 14 ICFGTFDVPCKANCGHWYCGSCILQYWKY 42 >ref|XP_006412296.1| hypothetical protein EUTSA_v10026077mg [Eutrema salsugineum] gi|557113466|gb|ESQ53749.1| hypothetical protein EUTSA_v10026077mg [Eutrema salsugineum] Length = 211 Score = 62.8 bits (151), Expect = 5e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICF +F VPCR CGHWYCG CILQYW+Y Sbjct: 69 ICFSSFTVPCRGNCGHWYCGSCILQYWSY 97 >ref|XP_006412295.1| hypothetical protein EUTSA_v10026077mg [Eutrema salsugineum] gi|557113465|gb|ESQ53748.1| hypothetical protein EUTSA_v10026077mg [Eutrema salsugineum] Length = 249 Score = 62.8 bits (151), Expect = 5e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICF +F VPCR CGHWYCG CILQYW+Y Sbjct: 69 ICFSSFTVPCRGNCGHWYCGSCILQYWSY 97 >ref|XP_006480137.1| PREDICTED: armadillo repeat-containing protein 6-like [Citrus sinensis] Length = 669 Score = 62.0 bits (149), Expect = 8e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG F +PC+A CGHWYC CILQ+WNY Sbjct: 35 ICFGDFTIPCKANCGHWYCANCILQFWNY 63 >ref|XP_006423067.1| hypothetical protein CICLE_v10029827mg, partial [Citrus clementina] gi|557525001|gb|ESR36307.1| hypothetical protein CICLE_v10029827mg, partial [Citrus clementina] Length = 314 Score = 62.0 bits (149), Expect = 8e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 122 ICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 ICFG F +PC+A CGHWYC CILQ+WNY Sbjct: 137 ICFGDFTIPCKANCGHWYCANCILQFWNY 165 >ref|XP_004230478.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform 2 [Solanum lycopersicum] Length = 208 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = +2 Query: 68 GVEEKRXXXXXXXXXXXXICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 GV+ +R ICFG F +PC+ CGHW+C CILQ W Y Sbjct: 6 GVKRRRESEKPPGDDCCPICFGDFSIPCKTNCGHWFCANCILQLWYY 52 >ref|XP_004230477.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like isoform 1 [Solanum lycopersicum] Length = 227 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = +2 Query: 68 GVEEKRXXXXXXXXXXXXICFGAFFVPCRAPCGHWYCGGCILQYWNY 208 GV+ +R ICFG F +PC+ CGHW+C CILQ W Y Sbjct: 25 GVKRRRESEKPPGDDCCPICFGDFSIPCKTNCGHWFCANCILQLWYY 71