BLASTX nr result
ID: Rauwolfia21_contig00030277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00030277 (1138 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB80748.1| hypothetical protein L484_008528 [Morus notabilis] 59 5e-06 >gb|EXB80748.1| hypothetical protein L484_008528 [Morus notabilis] Length = 770 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +2 Query: 500 APAEKFQALALAECIISSIGEEWLIGPMSLPEVQEPILT*TC 625 APAEKFQAL LA+ +IS IGE+WLIGP+ LP ++EPI C Sbjct: 360 APAEKFQALILAKAMISIIGEKWLIGPIQLPNLEEPISADRC 401