BLASTX nr result
ID: Rauwolfia21_contig00029299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00029299 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA49432.1| cytochrome P-450 [Catharanthus roseus] 56 4e-06 >emb|CAA49432.1| cytochrome P-450 [Catharanthus roseus] Length = 65 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 278 HFDWKLPGELQLKDIDMAEGTGMNCRRRDDLTLIPILNHC 159 HFDWKLPGEL+L+++DM E G+ RR+ DL LIPI C Sbjct: 22 HFDWKLPGELKLEELDMEESFGLTVRRKKDLLLIPISYAC 61