BLASTX nr result
ID: Rauwolfia21_contig00029171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00029171 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAI47572.1| phytoene synthase [Ipomoea sp. Kenyan] 65 2e-17 gb|AFP28795.1| phytoene synthase 1 [Vitis vinifera] 65 2e-17 ref|XP_002271575.1| PREDICTED: phytoene synthase, chloroplastic ... 65 2e-17 emb|CBI27361.3| unnamed protein product [Vitis vinifera] 65 2e-17 gb|AHJ90431.1| phytoene synthase [Pogostemon cablin] 64 5e-17 ref|XP_006348183.1| PREDICTED: phytoene synthase, chloroplastic-... 64 5e-17 gb|ABB52068.1| putative phytoene synthase [Daucus carota subsp. ... 64 5e-17 ref|NP_001234671.1| phytoene synthase 2, chloroplastic [Solanum ... 64 5e-17 ref|XP_006430395.1| hypothetical protein CICLE_v10011841mg [Citr... 64 5e-17 gb|ABY86652.1| phytoene synthase [Citrus maxima] 64 5e-17 gb|ABY86651.1| phytoene synthase [Citrus x microcarpa] 64 5e-17 ref|XP_002327564.1| predicted protein [Populus trichocarpa] gi|5... 64 5e-17 gb|ACY42664.1| phytoene synthase 1 [Manihot esculenta] gi|262292... 64 5e-17 gb|ACY42670.1| phytoene synthase 2 [Manihot esculenta] 64 5e-17 gb|ACY42665.1| phytoene synthase 2 [Manihot esculenta] gi|262292... 64 5e-17 ref|XP_006430396.1| hypothetical protein CICLE_v10011841mg [Citr... 64 5e-17 gb|ADR51672.1| chloroplast phytoene synthase [Catharanthus roseus] 65 5e-17 gb|ABQ23179.2| phytoene synthase [Camellia sinensis] 64 5e-17 sp|P37273.1|PSY2_SOLLC RecName: Full=Phytoene synthase 2, chloro... 64 5e-17 gb|AEQ30067.1| phytoene synthase [Mangifera indica] 64 5e-17 >dbj|BAI47572.1| phytoene synthase [Ipomoea sp. Kenyan] Length = 439 Score = 64.7 bits (156), Expect(2) = 2e-17 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTPERRRAIWAIYVWCRRTDELVD Sbjct: 161 YLGTMLMTPERRRAIWAIYVWCRRTDELVD 190 Score = 49.7 bits (117), Expect(2) = 2e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 143 SEAYDRCGEVCAEYAKTFYLG 163 >gb|AFP28795.1| phytoene synthase 1 [Vitis vinifera] Length = 438 Score = 64.7 bits (156), Expect(2) = 2e-17 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTPERRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTMLMTPERRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 2e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >ref|XP_002271575.1| PREDICTED: phytoene synthase, chloroplastic [Vitis vinifera] Length = 437 Score = 64.7 bits (156), Expect(2) = 2e-17 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTPERRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTMLMTPERRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 2e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >emb|CBI27361.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 64.7 bits (156), Expect(2) = 2e-17 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTPERRRAIWAIYVWCRRTDELVD Sbjct: 142 YLGTMLMTPERRRAIWAIYVWCRRTDELVD 171 Score = 49.7 bits (117), Expect(2) = 2e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 124 SEAYDRCGEVCAEYAKTFYLG 144 >gb|AHJ90431.1| phytoene synthase [Pogostemon cablin] Length = 439 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >ref|XP_006348183.1| PREDICTED: phytoene synthase, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565362904|ref|XP_006348184.1| PREDICTED: phytoene synthase, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 438 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTP+RRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTMLMTPDRRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >gb|ABB52068.1| putative phytoene synthase [Daucus carota subsp. sativus] Length = 438 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >ref|NP_001234671.1| phytoene synthase 2, chloroplastic [Solanum lycopersicum] gi|155965503|gb|ABU40771.1| phytoene synthase 2 [Solanum lycopersicum] gi|157703485|gb|ABV68559.1| phytoene synthase 2 [Solanum lycopersicum] Length = 438 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTP+RRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTMLMTPDRRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >ref|XP_006430395.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] gi|567875615|ref|XP_006430397.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] gi|567875617|ref|XP_006430398.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] gi|557532452|gb|ESR43635.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] gi|557532454|gb|ESR43637.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] gi|557532455|gb|ESR43638.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] Length = 437 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 161 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 190 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 143 SEAYDRCGEVCAEYAKTFYLG 163 >gb|ABY86652.1| phytoene synthase [Citrus maxima] Length = 437 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 161 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 190 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 143 SEAYDRCGEVCAEYAKTFYLG 163 >gb|ABY86651.1| phytoene synthase [Citrus x microcarpa] Length = 436 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 160 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 189 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 142 SEAYDRCGEVCAEYAKTFYLG 162 >ref|XP_002327564.1| predicted protein [Populus trichocarpa] gi|566210816|ref|XP_006372484.1| hypothetical protein POPTR_0017s02080g [Populus trichocarpa] gi|550319110|gb|ERP50281.1| hypothetical protein POPTR_0017s02080g [Populus trichocarpa] Length = 435 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 156 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 185 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 138 SEAYDRCGEVCAEYAKTFYLG 158 >gb|ACY42664.1| phytoene synthase 1 [Manihot esculenta] gi|262292927|gb|ACY42666.1| phytoene synthase 1 [Manihot esculenta] Length = 431 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 153 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 182 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 135 SEAYDRCGEVCAEYAKTFYLG 155 >gb|ACY42670.1| phytoene synthase 2 [Manihot esculenta] Length = 429 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 151 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 180 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 133 SEAYDRCGEVCAEYAKTFYLG 153 >gb|ACY42665.1| phytoene synthase 2 [Manihot esculenta] gi|262292929|gb|ACY42667.1| phytoene synthase 2 [Manihot esculenta] gi|262292931|gb|ACY42668.1| phytoene synthase 2 [Manihot esculenta] Length = 429 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 151 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 180 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 133 SEAYDRCGEVCAEYAKTFYLG 153 >ref|XP_006430396.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] gi|557532453|gb|ESR43636.1| hypothetical protein CICLE_v10011841mg [Citrus clementina] Length = 416 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 161 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 190 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 143 SEAYDRCGEVCAEYAKTFYLG 163 >gb|ADR51672.1| chloroplast phytoene synthase [Catharanthus roseus] Length = 379 Score = 64.7 bits (156), Expect(2) = 5e-17 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTPERRRAIWAIYVWCRRTDELVD Sbjct: 148 YLGTMLMTPERRRAIWAIYVWCRRTDELVD 177 Score = 48.5 bits (114), Expect(2) = 5e-17 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 S+AYDRCGEVCAEYAKTFYLG Sbjct: 130 SDAYDRCGEVCAEYAKTFYLG 150 >gb|ABQ23179.2| phytoene synthase [Camellia sinensis] Length = 329 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 143 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 172 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 125 SEAYDRCGEVCAEYAKTFYLG 145 >sp|P37273.1|PSY2_SOLLC RecName: Full=Phytoene synthase 2, chloroplastic; Flags: Precursor gi|437020|gb|AAA34187.1| phytoene synthase, partial [Solanum lycopersicum] Length = 310 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GTMLMTP+RRRAIWAIYVWCRRTDELVD Sbjct: 32 YLGTMLMTPDRRRAIWAIYVWCRRTDELVD 61 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 14 SEAYDRCGEVCAEYAKTFYLG 34 >gb|AEQ30067.1| phytoene synthase [Mangifera indica] Length = 239 Score = 63.5 bits (153), Expect(2) = 5e-17 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 FSGTMLMTPERRRAIWAIYVWCRRTDELVD 1 + GT+LMTPERRRAIWAIYVWCRRTDELVD Sbjct: 76 YLGTLLMTPERRRAIWAIYVWCRRTDELVD 105 Score = 49.7 bits (117), Expect(2) = 5e-17 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 239 SEAYDRCGEVCAEYAKTFYLG 177 SEAYDRCGEVCAEYAKTFYLG Sbjct: 58 SEAYDRCGEVCAEYAKTFYLG 78