BLASTX nr result
ID: Rauwolfia21_contig00028590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00028590 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW74661.1| putative LIM-type zinc finger domain family prote... 56 4e-06 >gb|AFW74661.1| putative LIM-type zinc finger domain family protein [Zea mays] Length = 148 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 15/54 (27%) Frame = -1 Query: 365 EKVSVNGTPYHKTCFRCTH---------------GGTREKCLGCSKTVYPTEKV 249 +K++ + YHK CFRC H GTREKC+GCSKTVYPTE+V Sbjct: 23 DKLTADNRIYHKACFRCHHCKGTLKNATKVSSAFAGTREKCVGCSKTVYPTERV 76