BLASTX nr result
ID: Rauwolfia21_contig00028437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00028437 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC23663.1| hypothetical protein L484_015573 [Morus notabilis] 55 1e-05 ref|XP_004964452.1| PREDICTED: mitochondrial inner membrane prot... 55 1e-05 >gb|EXC23663.1| hypothetical protein L484_015573 [Morus notabilis] Length = 166 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 296 IPLGLIRGRVTHIVWPPNRVGKVDRTVSQERLS 198 +PLGL+ GRVTHIVWPP R+G V+R V +ER+S Sbjct: 132 VPLGLVAGRVTHIVWPPQRIGAVERKVPEERIS 164 >ref|XP_004964452.1| PREDICTED: mitochondrial inner membrane protease subunit 2-like [Setaria italica] Length = 161 Score = 55.1 bits (131), Expect = 1e-05 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = -2 Query: 296 IPLGLIRGRVTHIVWPPNRVGKVDRTVSQERL 201 +PLGL++GRVTH+VWPPNR+G+VDR + + R+ Sbjct: 127 VPLGLMQGRVTHVVWPPNRIGRVDRKIPEGRI 158