BLASTX nr result
ID: Rauwolfia21_contig00028234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00028234 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242786.1| PREDICTED: uncharacterized protein LOC101250... 65 7e-09 ref|XP_006366961.1| PREDICTED: nucleolar and coiled-body phospho... 64 2e-08 ref|XP_004299795.1| PREDICTED: uncharacterized protein LOC101290... 57 2e-06 gb|EMJ23282.1| hypothetical protein PRUPE_ppa007564mg [Prunus pe... 57 3e-06 ref|XP_004134062.1| PREDICTED: uncharacterized protein LOC101208... 56 6e-06 emb|CBI17891.3| unnamed protein product [Vitis vinifera] 55 1e-05 emb|CAN75277.1| hypothetical protein VITISV_015753 [Vitis vinifera] 55 1e-05 >ref|XP_004242786.1| PREDICTED: uncharacterized protein LOC101250131 [Solanum lycopersicum] Length = 411 Score = 65.5 bits (158), Expect = 7e-09 Identities = 39/66 (59%), Positives = 45/66 (68%) Frame = +2 Query: 98 LTAFKPRQVLLAEQQQLKSKPALRMVKNPDENLNHKAGLNHSILNYLQKNGFSKTLKRFL 277 L AFKPRQV+LAE SK L M K ++N +K+GL SIL+YL NGFSKTLK FL Sbjct: 26 LLAFKPRQVVLAES----SKSNLVMAKK-EQNQENKSGLQQSILHYLHLNGFSKTLKYFL 80 Query: 278 KEAQIE 295 KE Q E Sbjct: 81 KETQTE 86 >ref|XP_006366961.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1-like [Solanum tuberosum] Length = 408 Score = 64.3 bits (155), Expect = 2e-08 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = +2 Query: 98 LTAFKPRQVLLAEQQQLKSKPALRMVKNPDENLNHKAGLNHSILNYLQKNGFSKTLKRFL 277 L AFKPRQV+LAE SK L M K ++N +K GL SIL+YL NGFSKTLK FL Sbjct: 26 LLAFKPRQVVLAES----SKSNLVMAKK-EQNQENKFGLQQSILHYLHLNGFSKTLKYFL 80 Query: 278 KEAQIE 295 KE Q E Sbjct: 81 KETQTE 86 >ref|XP_004299795.1| PREDICTED: uncharacterized protein LOC101290864 [Fragaria vesca subsp. vesca] Length = 382 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/67 (49%), Positives = 42/67 (62%) Frame = +2 Query: 95 SLTAFKPRQVLLAEQQQLKSKPALRMVKNPDENLNHKAGLNHSILNYLQKNGFSKTLKRF 274 SL AFKPRQVLL + L K + NP N + K L H++ +L+ NGFSKTLK+F Sbjct: 15 SLLAFKPRQVLLLANRNLHMKQS-----NP--NNDQKGPLLHTVAKFLEANGFSKTLKKF 67 Query: 275 LKEAQIE 295 L EA +E Sbjct: 68 LSEAPVE 74 >gb|EMJ23282.1| hypothetical protein PRUPE_ppa007564mg [Prunus persica] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +2 Query: 95 SLTAFKPRQVLLAEQQQLK-SKPALRMVKNPDENLNHKAGLNHSILNYLQKNGFSKTLKR 271 +L AF+PRQV LA + +K SKP + + K L H++ +L+ NGFSKTLK+ Sbjct: 15 TLLAFRPRQVQLANLEDMKHSKPNISSDSTQTLSPGQKGPLLHAVARFLESNGFSKTLKK 74 Query: 272 FLKEAQIE 295 F EAQIE Sbjct: 75 FRSEAQIE 82 >ref|XP_004134062.1| PREDICTED: uncharacterized protein LOC101208847 [Cucumis sativus] Length = 426 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = +2 Query: 107 FKPRQVLLAEQQQLKSKPALRMVKNPDENLN----HKAGLNHSILNYLQKNGFSKTLKRF 274 FKPRQVLL+ +S + + DE L+ H+ L H++ +L++NGFSKTLK+F Sbjct: 8 FKPRQVLLSHHTMKQSNNHTQAPNSADETLSLHPQHRTLLLHAVAFFLERNGFSKTLKKF 67 Query: 275 LKEAQIE 295 EAQIE Sbjct: 68 RSEAQIE 74 >emb|CBI17891.3| unnamed protein product [Vitis vinifera] Length = 461 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/67 (47%), Positives = 41/67 (61%) Frame = +2 Query: 95 SLTAFKPRQVLLAEQQQLKSKPALRMVKNPDENLNHKAGLNHSILNYLQKNGFSKTLKRF 274 SLTAFKPR V+L+ Q NP + K L+ SIL+YLQ++GFSKTLK F Sbjct: 9 SLTAFKPRSVMLSNQAMNNLSNKTSKTLNPCQK---KTLLHSSILHYLQRSGFSKTLKYF 65 Query: 275 LKEAQIE 295 +EA +E Sbjct: 66 QREAPLE 72 >emb|CAN75277.1| hypothetical protein VITISV_015753 [Vitis vinifera] Length = 902 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/67 (47%), Positives = 41/67 (61%) Frame = +2 Query: 95 SLTAFKPRQVLLAEQQQLKSKPALRMVKNPDENLNHKAGLNHSILNYLQKNGFSKTLKRF 274 SLTAFKPR V+L+ Q NP + K L+ SIL+YLQ++GFSKTLK F Sbjct: 438 SLTAFKPRSVMLSNQAMNNLSNKTSKTLNPCQK---KTLLHSSILHYLQRSGFSKTLKYF 494 Query: 275 LKEAQIE 295 +EA +E Sbjct: 495 QREAPLE 501