BLASTX nr result
ID: Rauwolfia21_contig00027893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00027893 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275817.1| PREDICTED: uncharacterized protein P11E10.01... 60 3e-07 gb|EXC05955.1| hypothetical protein L484_014224 [Morus notabilis] 55 7e-06 >ref|XP_002275817.1| PREDICTED: uncharacterized protein P11E10.01 [Vitis vinifera] Length = 340 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 239 RRDSDEITVFKSVGSAVVDLLSAQLVYETYMNN 141 RRDS+E+TVFKSVGSAVVD+LSAQLVYETY+ N Sbjct: 304 RRDSEEVTVFKSVGSAVVDILSAQLVYETYIKN 336 >gb|EXC05955.1| hypothetical protein L484_014224 [Morus notabilis] Length = 332 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 239 RRDSDEITVFKSVGSAVVDLLSAQLVYETYM 147 RRDS+E+TVFKSVGSA VD+L+AQLVYETY+ Sbjct: 298 RRDSEEVTVFKSVGSAAVDILAAQLVYETYL 328