BLASTX nr result
ID: Rauwolfia21_contig00027855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00027855 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] 64 2e-08 >gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] Length = 112 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = +1 Query: 58 MAEGK*VRHSFSHTPGEKVTIASPHRPESLQDEQGEINPSTLEIHIDQLITSSC 219 M E K VRHSFSHTPGEKVTIAS + G PSTLEIHIDQ I++SC Sbjct: 59 MTEQKWVRHSFSHTPGEKVTIASSSPAGEPPGQGGGGQPSTLEIHIDQSISASC 112