BLASTX nr result
ID: Rauwolfia21_contig00027820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00027820 (283 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270277.2| PREDICTED: carboxypeptidase A2-like [Vitis v... 62 6e-08 >ref|XP_002270277.2| PREDICTED: carboxypeptidase A2-like [Vitis vinifera] gi|297745543|emb|CBI40708.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 164 FVLVFFACFSLINGKVNLTRPSFTPINRDLYHTSGALMEE 283 F LVFF FS +NGK NLT PSFTPIN DLYH+SG LMEE Sbjct: 16 FPLVFFVFFSPVNGKDNLTPPSFTPINGDLYHSSGLLMEE 55