BLASTX nr result
ID: Rauwolfia21_contig00027592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00027592 (936 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB95363.1| hypothetical protein L484_014336 [Morus notabilis] 58 5e-06 ref|XP_003522245.1| PREDICTED: coiled-coil domain-containing pro... 58 6e-06 >gb|EXB95363.1| hypothetical protein L484_014336 [Morus notabilis] Length = 229 Score = 58.2 bits (139), Expect = 5e-06 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 10/64 (15%) Frame = +1 Query: 406 QSRKISIEEEYERTVLVKNTNLDSSILEDRTIEEAIAQMTV----------EGYPKASWK 555 Q + + EEEYER VLV NTN D SI+E RT+E+A+AQMTV E KAS+K Sbjct: 127 QQSRTAAEEEYERMVLVTNTNRDDSIIEARTVEDAVAQMTVADNLPVDRHPERRLKASFK 186 Query: 556 AFSQ 567 AF + Sbjct: 187 AFEE 190 >ref|XP_003522245.1| PREDICTED: coiled-coil domain-containing protein 124-like [Glycine max] Length = 229 Score = 57.8 bits (138), Expect = 6e-06 Identities = 33/69 (47%), Positives = 43/69 (62%), Gaps = 10/69 (14%) Frame = +1 Query: 406 QSRKISIEEEYERTVLVKNTNLDSSILEDRTIEEAIAQMTV----------EGYPKASWK 555 Q + + EEEYER VL+ NTN D SI+E RT+++AIAQMTV E KAS+K Sbjct: 127 QQSRTAAEEEYERMVLISNTNRDDSIIEARTLDDAIAQMTVVDNLPPDRHPERRLKASFK 186 Query: 556 AFSQEKKKK 582 AF + + K Sbjct: 187 AFEEAELPK 195