BLASTX nr result
ID: Rauwolfia21_contig00027484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00027484 (491 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37113.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_002273202.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 55 7e-06 >emb|CBI37113.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 95 MQMKIEDDSRPLAHRMVESFLNKFFPSGYPY 3 + MK+ DDSR + HR+VESFLNKFFPSGYPY Sbjct: 39 LSMKVVDDSRTVVHRVVESFLNKFFPSGYPY 69 >ref|XP_002273202.1| PREDICTED: UPF0420 protein C16orf58 homolog [Vitis vinifera] Length = 420 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 95 MQMKIEDDSRPLAHRMVESFLNKFFPSGYPY 3 + MK+ DDSR + HR+VESFLNKFFPSGYPY Sbjct: 35 LSMKVVDDSRTVVHRVVESFLNKFFPSGYPY 65