BLASTX nr result
ID: Rauwolfia21_contig00027341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00027341 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 118 7e-25 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 71 1e-10 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 118 bits (296), Expect = 7e-25 Identities = 55/58 (94%), Positives = 55/58 (94%) Frame = +3 Query: 3 GLGWANLWCTGCYANSSAGQLSWYGRTAAPREILLYTSSRTRFLNRTSIGERCKHREV 176 GLGWANLW TGCYANSSAG LSWYGRTAA REILLYTSSRTRFLNRTSIGERCKHREV Sbjct: 27 GLGWANLWSTGCYANSSAGLLSWYGRTAAQREILLYTSSRTRFLNRTSIGERCKHREV 84 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 198 RLVRDRFTPHGAYTSRLSKFCSKTSSENLYREGFP 94 RLVRDRFTP GAYTSRLSKFCSKTS ENLYREGFP Sbjct: 360 RLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFP 394