BLASTX nr result
ID: Rauwolfia21_contig00026776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00026776 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004249767.1| PREDICTED: protein PHYTOCHROME KINASE SUBSTR... 55 1e-05 >ref|XP_004249767.1| PREDICTED: protein PHYTOCHROME KINASE SUBSTRATE 4-like [Solanum lycopersicum] Length = 493 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 3/43 (6%) Frame = -2 Query: 338 GNGLLSCRHEKAVNVGPHPVKC-LQEGPP--LPLISASGHVST 219 G GLLSCRHEKAVNVGP PVK +GPP LPL S +GHV + Sbjct: 430 GGGLLSCRHEKAVNVGPQPVKYGSPDGPPSQLPLKSTAGHVGS 472